Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM14 (PAM18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAM18; TIM14; CAALFM_C400520WA; CaO19.11667; CaO19.4190; Mitochondrial import inner membrane translocase subunit TIM14; Presequence translocated-associated motor subunit PAM18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
PAM18
Target Protein Sequence
MAPLEAPILAIPGENNTHQQQQQQFQYTGQLQKKKAAEGSIEWYFDQTINFMGDHPVITG IGAFAVAYFAAGFIKSNQPGINGKAFVKGGFGAKMTAKEALQILNLKETNLSKLKLKEQH RKLMMANHPDKGGSSYIATKINEAKDFLDKRGGMKPK
Uniprot No.

Target Background

Function

Recombinant Candida albicans Mitochondrial Import Inner Membrane Translocase Subunit TIM14 (PAM18) is an essential component of the PAM complex. This complex is crucial for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the mitochondrial matrix. Within the PAM complex, TIM14/PAM18 is specifically required to stimulate the activity of mtHSP70 (SSC1).

Database Links
Protein Families
TIM14 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the structural composition of TIM14/PAM18 from C. albicans?

Recombinant full-length C. albicans mitochondrial import inner membrane translocase subunit TIM14/PAM18 (Q59SI2) consists of 157 amino acids . Like its yeast homolog, it contains an N-terminal hydrophobic domain that plays a role in membrane association and a matrix-exposed J-domain. The J-domain is critical for its function in protein translocation, as it interacts with mitochondrial Hsp70 (mtHsp70) to stimulate ATPase activity. For recombinant protein expression, most researchers use E. coli expression systems with fusion tags (typically His-tags) at the N-terminus to facilitate purification .

How does TIM14/PAM18 function in the mitochondrial protein import system?

TIM14/PAM18 is an essential component of the mitochondrial translocation motor that facilitates the import of proteins into the mitochondrial matrix. It functions primarily by:

  • Docking to the TIM23 complex

  • Assisting TIM44 to bind mitochondrial Hsp70

  • Directly stimulating ATP hydrolysis catalyzed by mtHsp70

Studies using yeast homologs demonstrate that TIM14/PAM18 significantly increases the ATPase activity of mtHsp70 from a basal level of approximately 1 turnover/minute to much higher rates. This stimulation is critical for the ATP-dependent translocation of precursor proteins across the inner mitochondrial membrane .

What is the recommended protocol for purifying recombinant C. albicans TIM14/PAM18?

Based on protocols developed for yeast TIM14/PAM18, a three-step purification process is recommended:

  • Initial purification using Ni-agarose affinity chromatography (for His-tagged constructs)

  • Tag removal using TEV protease followed by a second Ni column step

  • Final purification by gel filtration to achieve >95% purity

For optimal results, include protease inhibitors during cell lysis and maintain the protein at 4°C throughout the purification process to minimize degradation of this thermally unstable protein. Typical yield from bacterial expression systems is approximately 2-5 mg of purified protein per liter of culture.

How stable is the recombinant TIM14/PAM18 protein, and what storage conditions are recommended?

Individual TIM14/PAM18 proteins demonstrate poor thermal stability. Based on studies with yeast homologs, the isolated J-domain of TIM14/PAM18 has a melting temperature (Tm) of approximately 16.5°C, making it extremely unstable at room temperature . For storage:

  • Store at -80°C in small aliquots to avoid repeated freeze-thaw cycles

  • Use buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM DTT, and 10% glycerol

  • For experiments, maintain protein samples on ice and use within 2-3 hours of thawing

When complexed with TIM16/PAM16, the stability increases significantly (Tm ~40-41°C), suggesting that co-expression with its binding partner may be advantageous for certain applications .

What methodologies are most effective for studying the interaction between TIM14/PAM18 and TIM16/PAM16?

Several complementary approaches have proven effective for investigating the TIM14/PAM18-TIM16/PAM16 interaction:

  • Co-expression systems: Co-express both proteins in bacteria, with only one containing a His-tag. Purification of both proteins together confirms complex formation .

  • Cross-linking analysis: Use bifunctional reagents like DSS (disuccinimidyl suberate) to analyze oligomeric states. This reveals whether proteins form monomers, homodimers, or heterodimers .

  • Circular Dichroism (CD) spectroscopy: Analyze secondary structure content and thermal stability. Compare individual proteins versus complexes to assess stabilization effects .

  • ATPase activity assays: Measure the effect of TIM14/PAM18 on mtHsp70 ATPase activity in the presence/absence of TIM16/PAM16 to assess functional interactions .

Analysis MethodInformation ProvidedTechnical Considerations
Co-expression & co-purificationPhysical associationRequires only one tagged partner
Cross-linkingOligomeric stateTime-dependent; may cause aggregation
CD spectroscopySecondary structure, thermal stabilityRequires pure protein samples
ATPase assaysFunctional interactionRequires active mtHsp70

How do researchers analyze the domain-specific functions of TIM14/PAM18 through recombinant protein engineering?

Domain-specific analysis of TIM14/PAM18 typically employs these approaches:

  • Truncation constructs: Express only the J-domain (soluble portion) for functional studies. For C. albicans TIM14/PAM18, researchers commonly use constructs containing amino acids similar to those used for yeast (approximately residues 84-169 of the yeast protein) .

  • Site-directed mutagenesis: Target key residues in the J-domain, particularly the HPD motif critical for interaction with mtHsp70. The conserved His-Pro-Asp motif is essential for stimulating ATPase activity .

  • Chimeric proteins: Create fusion proteins between TIM14/PAM18 domains from different species to map species-specific functions. For example, a single point mutation (A139N) in bacterial TimB was sufficient to allow it to function in yeast mitochondria .

  • In vitro reconstitution: Combine purified TIM14/PAM18, TIM16/PAM16, and mtHsp70 to measure effects on ATPase activity. This system allows precise control over component ratios and conditions .

When designing experiments, consider that the soluble J-domain alone is sufficient for ATPase stimulation but lacks the membrane-anchoring function of the full-length protein.

What are the experimental challenges in working with recombinant C. albicans TIM14/PAM18) and how can they be overcome?

Several challenges exist when working with recombinant C. albicans TIM14/PAM18:

  • Thermal instability: The isolated protein is extremely unstable (Tm ~16.5°C based on yeast homolog data).

    • Solution: Co-express with TIM16/PAM16 to form a more stable complex (Tm ~40-41°C) .

  • Aggregation propensity: Cross-linking studies show that TIM14/PAM18 tends to aggregate over time.

    • Solution: Use fresh preparations, include stabilizing agents like glycerol, and avoid concentration above 1-2 mg/ml .

  • Membrane association: The N-terminal hydrophobic domain can cause solubility issues.

    • Solution: Express only the soluble domain (J-domain) for many functional studies, or use mild detergents for full-length protein .

  • Species-specific interactions: Human and yeast proteins show conserved structure but some functional differences.

    • Solution: Compare homologs from multiple species and use heterologous complexes to identify conserved interaction surfaces .

How does the TIM14/PAM18-TIM16/PAM16 complex from C. albicans compare to homologs from other species?

Comparative studies between fungal, yeast, and human TIM14/PAM18-TIM16/PAM16 complexes reveal:

  • Structural conservation: The core J-domain structure is highly conserved across species. Yeast and human proteins can form heterologous complexes, demonstrating structural compatibility .

  • Functional conservation: Human TIM16/PAM16 can inhibit yeast TIM14/PAM18's stimulation of mtHsp70 ATPase activity by approximately 50%, compared to 65% inhibition by yeast TIM16/PAM16, indicating conserved but not identical functional properties .

  • Thermal stability differences: The stability of the complex appears similar across species, with heterologous complexes showing intermediate stability compared to homologous complexes.

  • Evolutionary adaptations: In bacterial ancestors (like TimA and TimB in C. crescentus), these proteins do not interact with each other but have separate functions. Minimal mutations (such as A139N in TimB) can convert bacterial TimB to function in the yeast mitochondrial system .

This cross-species compatibility suggests that C. albicans TIM14/PAM18 likely forms complexes with similar properties to those observed in other fungi and yeasts, though species-specific differences in regulatory mechanisms may exist.

What methodologies are recommended for investigating the role of C. albicans TIM14/PAM18) in mitochondrial disease models?

For investigating potential roles in mitochondrial disease:

  • Complementation assays: Test if C. albicans TIM14/PAM18 can complement deletion of TIM14/PAM18 in other species. Heterozygous TIM14/Δtim14 yeast cells transformed with the C. albicans gene can be used to test functional conservation .

  • Immunolocalization: Use immunofluorescence microscopy with specific antibodies or epitope-tagged proteins to confirm mitochondrial localization in various cell types. This approach has been successfully used to localize homologous proteins in organisms like Giardia and Trichomonas .

  • Membrane topology analysis: Develop "mitoplasting" assays to determine the membrane orientation of TIM14/PAM18. This involves selective permeabilization of outer membranes followed by protease treatment to assess protein accessibility .

  • Protein-protein interaction networks: Use immunoprecipitation followed by mass spectrometry to identify novel interaction partners beyond the known TIM16/PAM16 interaction .

  • Blue native PAGE: Resolve native protein complexes to determine if C. albicans TIM14/PAM18 forms multiple distinct complexes, as seen with bacterial homologs that form complexes of approximately 100 kDa and 150 kDa .

What controls should be included when using recombinant C. albicans TIM14/PAM18) in functional assays?

When designing functional assays with recombinant C. albicans TIM14/PAM18, include these essential controls:

  • Negative controls:

    • Buffer-only control without TIM14/PAM18

    • Heat-inactivated TIM14/PAM18 (incubated at 65°C for 10 minutes)

    • J-domain mutant (H/Q mutation in the HPD motif) that abolishes J-domain function

  • Positive controls:

    • Well-characterized homolog (e.g., S. cerevisiae TIM14/PAM18)

    • Known-active batch of the same protein preparation

  • Specificity controls:

    • Unrelated J-proteins to demonstrate specific rather than generic J-protein effects

    • TIM14/PAM18 from distantly related species to assess evolutionary conservation

  • Complex formation controls:

    • TIM14/PAM18 alone vs. TIM14/PAM18-TIM16/PAM16 complex

    • Varying ratios of TIM14/PAM18:TIM16/PAM16 to assess stoichiometric effects

For ATPase assays specifically, include mtHsp70 alone and mtHsp70 with its nucleotide exchange factor (Mge1) as baseline controls .

How can researchers troubleshoot issues with expression and purification of recombinant C. albicans TIM14/PAM18)?

Common issues and solutions for recombinant C. albicans TIM14/PAM18 production:

IssuePossible CausesTroubleshooting Strategies
Poor expressionCodon bias, protein toxicityUse codon-optimized sequence, reduce induction temperature to 16-18°C, try different E. coli strains (BL21 tuner recommended)
Inclusion body formationHydrophobic N-terminal domain, misfoldingExpress only the J-domain, co-express with TIM16/PAM16, add solubility tags (SUMO, MBP), use auto-induction media
Protein aggregation during purificationThermal instability, hydrophobic interactionsKeep samples at 4°C, include 5-10% glycerol and 1 mM DTT in all buffers, avoid concentrating above 1-2 mg/ml
Protein degradationProtease sensitivityAdd protease inhibitors, reduce purification time, express with C-terminal rather than N-terminal tags
Low purityNon-specific binding to purification resinIncrease imidazole in wash buffers (for His-tag purification), add second purification step (ion exchange, size exclusion)

For optimal results with full-length protein, consider co-expression with TIM16/PAM16 to enhance stability throughout the purification process .

What are the recommended protocols for assessing the interaction between C. albicans TIM14/PAM18) and mitochondrial Hsp70?

To study the interaction between C. albicans TIM14/PAM18 and mtHsp70, these protocols are recommended:

  • ATPase activity assay:

    • Incubate purified mtHsp70 (2 μM) with nucleotide exchange factor Mge1 (0.5 μM)

    • Add varying concentrations of TIM14/PAM18 (0.1-2 μM)

    • Measure ATP hydrolysis using malachite green assay or radioactive ATP

    • Compare results with and without TIM16/PAM16 to assess regulatory effects

  • Surface plasmon resonance (SPR):

    • Immobilize mtHsp70 on sensor chip

    • Flow TIM14/PAM18 over the surface at different concentrations

    • Determine association and dissociation rate constants

    • Test different nucleotide conditions (ATP, ADP, nucleotide-free)

  • Co-immunoprecipitation:

    • Prepare antibodies against C. albicans TIM14/PAM18

    • Perform pull-down experiments from mitochondrial extracts

    • Analyze associated proteins by Western blotting

    • Compare results under different ATP/ADP conditions

  • Cross-linking coupled to mass spectrometry:

    • Use bifunctional cross-linkers like DSS

    • Mix purified TIM14/PAM18 and mtHsp70

    • Digest cross-linked complexes and analyze by mass spectrometry

    • Map interaction surfaces based on cross-linked peptides

How might C. albicans TIM14/PAM18 function differ in pathogenic versus non-pathogenic contexts?

Emerging research suggests that mitochondrial function, including protein import machinery, may play roles in pathogenicity:

  • Stress adaptation: During host invasion, C. albicans faces oxidative stress that may require upregulation of mitochondrial import to repair damage. TIM14/PAM18 expression and activity may be modulated during this process.

  • Morphological switching: C. albicans transitions between yeast and hyphal forms during infection. This transition involves metabolic remodeling that may affect mitochondrial protein composition and thus import requirements.

  • Drug resistance mechanisms: Some antifungal resistance mechanisms involve mitochondrial functions. Changes in TIM14/PAM18 activity could affect mitochondrial proteome composition and thus drug susceptibility.

  • Comparative analysis: Studies comparing TIM14/PAM18 from pathogenic C. albicans with non-pathogenic fungi could reveal adaptations specific to virulence. The extent of sequence conservation between C. albicans TIM14/PAM18 and human homologs may also influence drug targeting strategies.

To investigate these aspects, researchers should compare TIM14/PAM18 expression, localization, and interaction partners under different growth conditions mimicking host environments.

What novel applications might exploit the structural properties of the TIM14/PAM18-TIM16/PAM16 complex?

The unique characteristics of this protein complex suggest several innovative research applications:

  • Protein stability engineering: The dramatic increase in thermal stability observed when TIM14/PAM18 and TIM16/PAM16 form a complex (Tm increases from 16.5°C to ~41°C) provides a model system for studying protein stabilization through complex formation. This principle could be applied to stabilize other thermally labile proteins.

  • Drug target development: The essential nature of this complex in fungi makes it a potential antifungal target. The interface between TIM14/PAM18 and TIM16/PAM16 could be targeted to disrupt complex formation and thus mitochondrial function in pathogenic fungi.

  • Heterologous expression systems: The ability of TIM14/PAM18 to form functional complexes with TIM16/PAM16 from different species suggests the possibility of creating chimeric complexes with novel properties for biotechnology applications.

  • Mitochondrial targeting systems: The membrane-targeting domain of TIM14/PAM18 could be utilized to develop new methods for delivering therapeutic cargoes specifically to mitochondria.

  • Evolution studies: The minimal mutation required to convert bacterial TimB to function in yeast mitochondria (single A139N mutation) provides an excellent model for studying protein evolution and the minimal requirements for new protein-protein interactions.

How does C. albicans TIM14/PAM18 compare structurally and functionally to human mitochondrial import machinery?

Comparative analysis reveals both conservation and divergence between fungal and human mitochondrial import systems:

FeatureC. albicans/Yeast TIM14/PAM18Human TIM14/PAM18Significance
Protein structureContains J-domain and membrane anchorContains J-domain and membrane anchor; exists in two forms in humans Core functional domains conserved
Complex formationForms heterodimer with TIM16/PAM16Forms heterodimer with Magmas (human TIM16/PAM16) Complex formation mechanism conserved
RegulationRegulated by single TIM16/PAM16Single regulator (Magmas) for two forms of human J-proteins More complex regulation in humans
Thermal stabilityIndividual protein unstable (Tm ~16.5°C); Complex stable (Tm ~41°C) Similar thermal stability profile to yeast proteins Stabilization through complex formation conserved
Cross-species functionalityCan form functional complexes with human TIM16/PAM16 Can form functional complexes with yeast TIM16/PAM16 Structural interfaces highly conserved

This comparative analysis provides a foundation for using fungal models to understand mitochondrial import mechanisms while highlighting important species-specific differences that should be considered when translating findings across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.