Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
TIM50; CAALFM_C111220CA; CaO19.680; CaO19.8297; Mitochondrial import inner membrane translocase subunit TIM50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-469
Protein Length
Full Length of Mature Protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
TIM50
Target Protein Sequence
HCVLPSTRMAVSPILNQSIKFYSSKDNATDKSQEKEQPKSILNDDMLARAGFEDVDPKEE TSNSEEQATKQTGRKRKRAQTSKDLQRERYANMFYLSALIFGVAGVGYMSRDWDSEKEQE EMDGKNVENGYTPKLMYERLSKRLGSLFTFFSEPAFENLLPPPPPEQYRRPLTLVVTLDD FLIHSNWDTQHGWRTGKRPGLDYFLGYLSQYYEIVVFSSNSQIYSDKTVNKLDPYHAYIS YALFREACRYKDGKLIKDLSLLNRDLGKTVMIDVDEDSAALQPENSIIVKKWEGQPDEYL ISLIPFLEYLATQPVKDVRPILNSYKDKSNIVAEFAERENKLREQWRKDHGGNNGKPNAG NFIAKLLGIPVPEPKMPLDIIREHGQLQYEHFQKYLQENAHKFLEEEQKLKDEFGKVTLN KLITEGAPNAEEIAKVQQQRALEEAQKQQEGHK
Uniprot No.

Target Background

Function

TIM50 is a crucial component of the TIM23 complex, responsible for the translocation of proteins containing transit peptides across the mitochondrial inner membrane. Its function includes guiding preproteins during transit, directing them to the TIM23 channel protein, and potentially facilitating the transfer of translocating proteins from the TOM complex to the TIM23 complex.

Database Links
Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure of Candida albicans TIM50 protein?

Candida albicans TIM50 is a mitochondrial inner membrane protein that spans the membrane with a single transmembrane domain (TMD). The protein consists of 469 amino acids (with the mature form spanning residues 17-469), containing a smaller N-terminal domain exposed to the matrix and a larger C-terminal domain exposed to the intermembrane space (IMS) . The IMS-exposed domain is particularly important for the protein's function in preprotein recognition and transfer. The protein has a coiled-coil region that may be involved in interactions with other components of the TIM23 complex, and contains a phosphatase-like motif in its C-terminal region . Similar to TIM50 in other species, the Candida albicans variant likely possesses conserved residues within its IMS-exposed domain that are crucial for its function in preprotein recognition.

What is the functional role of TIM50 in mitochondrial protein import?

TIM50 plays a critical role in the transfer of preproteins from the translocase of the outer membrane (TOM complex) to the translocase of the inner membrane (TIM23 complex) . It acts as a receptor in the intermembrane space that recognizes and binds to preproteins emerging from the TOM complex. This interaction is essential for guiding preproteins to the TIM23 channel, facilitating their translocation across or insertion into the inner membrane . TIM50 depletion studies have shown strongly reduced import kinetics of preproteins using the TIM23 complex, underscoring its essential role in mitochondrial protein import . Additionally, TIM50 helps maintain the permeability barrier of the mitochondrial inner membrane, thus preserving the membrane potential necessary for protein import .

How does TIM50 interact with other components of the mitochondrial protein import machinery?

TIM50 interacts directly with TIM23, the channel-forming component of the TIM23 complex . This interaction primarily occurs through the IMS-exposed domain of TIM50. Cross-linking studies have shown that TIM50 can be linked to preproteins halted at the level of the TOM complex or spanning both TOM and TIM23 complexes, suggesting its role in preprotein transfer between these complexes . The specific amino acid residues involved in these interactions vary between species, but conserved hydrophobic and charged residues in the IMS domain are typically crucial. TIM50 also interacts with TIM17, another core component of the TIM23 complex . These interactions collectively enable TIM50 to function effectively in preprotein recognition and transfer during mitochondrial protein import.

What expression systems are most effective for producing recombinant Candida albicans TIM50?

E. coli is an effective expression system for producing recombinant Candida albicans TIM50, particularly when expressing the mature protein (residues 17-469) with an N-terminal His-tag . For optimal expression, consider using bacterial strains optimized for expressing eukaryotic proteins, such as BL21(DE3) or Rosetta strains that supply additional tRNAs for rare codons. The expression construct should be designed to exclude the native mitochondrial targeting sequence to avoid potential toxicity or improper folding. Expression should be induced at lower temperatures (16-20°C) to enhance proper folding and solubility. Alternatively, yeast expression systems (like Pichia pastoris) can be considered for expressing fungal proteins when E. coli expression results in insoluble or improperly folded protein. The choice between prokaryotic and eukaryotic expression systems should be guided by the specific experimental requirements and the need for post-translational modifications.

What purification strategies work best for recombinant TIM50 protein?

For His-tagged recombinant Candida albicans TIM50, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is an effective first purification step . The purification should be performed under native conditions to maintain protein structure and function. A typical protocol would include:

  • Cell lysis in a buffer containing 20-50 mM Tris-HCl pH 8.0, 300-500 mM NaCl, 10-20 mM imidazole, and protease inhibitors

  • IMAC purification with gradient elution using increasing imidazole concentrations (50-300 mM)

  • Further purification by size exclusion chromatography to remove aggregates and obtain a homogeneous preparation

For functional studies, it's crucial to verify that the purified protein maintains its native conformation. This can be assessed through circular dichroism spectroscopy or limited proteolysis. For storage, the purified protein can be kept in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C . Avoiding repeated freeze-thaw cycles is essential for maintaining protein activity.

What methods can be used to study TIM50 interaction with preproteins?

Several methods can be employed to study TIM50 interactions with preproteins:

  • Cross-linking assays: Chemical cross-linkers can be used to capture transient interactions between TIM50 and preproteins during import . This approach has successfully demonstrated TIM50's role in interacting with preproteins at various stages of import.

  • Pull-down assays: Recombinant His-tagged TIM50 can be immobilized on Ni-NTA resin and used to pull down interacting preproteins from mitochondrial extracts or in vitro translation products.

  • Surface plasmon resonance (SPR): This technique allows real-time, label-free detection of TIM50-preprotein interactions, providing kinetic and affinity data.

  • Microscale thermophoresis (MST): A more recent technique that can detect interactions with minimal protein consumption and in near-native conditions.

  • In vitro import assays: Using isolated mitochondria with manipulated levels of TIM50 (either depleted or overexpressed) to assess the impact on import efficiency of various preproteins .

For these interaction studies, it's important to use properly folded TIM50 and physiologically relevant preprotein substrates, ideally with their native targeting sequences.

How do different domains of TIM50 contribute to its function in protein translocation?

TIM50 contains distinct domains that perform specialized functions during protein translocation. Recent research has revealed that TIM50 consists of at least two functional domains that can work in trans: a core domain anchored to the inner membrane and a presequence-binding domain (PBD) . The PBD (approximately residues 366-476 in yeast) is exclusively located in the intermembrane space and is responsible for binding to the presequences of incoming preproteins . The core domain (approximately residues 1-365) is anchored to the inner membrane and interacts with other components of the TIM23 complex, particularly TIM23 itself.

Experiments involving split versions of TIM50 expressed in trans have demonstrated that these domains can function separately yet cooperatively . When the PBD is expressed as an IMS-targeted soluble domain and co-expressed with the membrane-anchored core domain, yeast cells remain viable, indicating that a contiguous TIM50 protein is not strictly necessary for function . This suggests a model where the core domain primarily serves as an anchor and mediator of interactions with other TIM components, while the PBD functions as a mobile receptor that captures preproteins in the intermembrane space and guides them to the TIM23 channel.

What is the significance of the phosphatase-like domain in fungal TIM50 proteins?

The C-terminal region of TIM50 contains a phosphatase-like motif that resembles the catalytic domain of the haloacid dehalogenase (HAD) superfamily of phosphatases, particularly the transcription factor TFIIF-stimulated CTD phosphatase . The functional significance of this domain varies between species. In fungal TIM50 proteins, including those from Saccharomyces cerevisiae and likely Candida albicans, the phosphatase motif (DXDX(T/V)) is not perfectly conserved, resulting in the absence of phosphatase activity .

How does TIM50 contribute to maintaining mitochondrial membrane potential?

TIM50 plays a critical role in maintaining the mitochondrial inner membrane permeability barrier, which is essential for preserving membrane potential. The mechanism involves several aspects:

  • Regulation of TIM23 channel gating: TIM50 interacts with the N-terminal domain of TIM23, which extends into the intermembrane space. This interaction is believed to help keep the TIM23 channel closed in the absence of translocating preproteins, preventing proton leakage across the inner membrane .

  • Preprotein-dependent channel opening: When TIM50 binds to a preprotein, it undergoes conformational changes that alter its interaction with TIM23, allowing controlled opening of the channel specifically for preprotein translocation.

  • Coordination with other TIM23 components: TIM50 works in concert with other components like TIM17 and the import motor (PAM complex) to ensure that channel opening is tightly coupled to preprotein translocation.

Experimental evidence from various systems, including Trypanosoma brucei, has shown that both knockdown and overexpression of TIM50 affect mitochondrial membrane potential . TIM50 knockdown reduces membrane potential, likely due to increased proton leakage through improperly regulated TIM23 channels. Interestingly, overexpression can also be detrimental, possibly by disrupting the stoichiometry of the TIM23 complex components or by affecting the dynamic interactions necessary for proper channel regulation.

How does Candida albicans TIM50 differ structurally and functionally from TIM50 in other fungal species?

Candida albicans TIM50 shares significant structural similarities with TIM50 proteins from other fungal species, but also exhibits some distinct features. While the complete structural characterization of C. albicans TIM50 is not fully detailed in the provided search results, comparative analysis with other fungal TIM50 proteins reveals likely similarities and differences:

  • Transmembrane domain (TMD): Like other fungal TIM50 proteins, C. albicans TIM50 likely contains a single TMD near its N-terminal region. In Saccharomyces cerevisiae (ScTim50), this domain is located within amino acids 112-132, while in Neurospora crassa (NcTim50), it spans residues 171-191 . The exact position in C. albicans TIM50 may differ but would serve the same function of anchoring the protein to the inner mitochondrial membrane.

  • Intermembrane space domain: The C-terminal domain exposed to the intermembrane space is likely larger than the matrix-exposed N-terminal domain, similar to other fungal TIM50 proteins. This domain contains the preprotein-binding region crucial for recognizing and binding mitochondrial targeting sequences.

  • Phosphatase-like domain: Like other fungal TIM50 proteins, C. albicans TIM50 likely contains a C-terminal phosphatase-like domain that lacks perfect conservation of the catalytic DXDX(T/V) motif, resulting in the absence of phosphatase activity . This domain would still play a structural role in preprotein binding.

  • Cysteine residues: The number and distribution of cysteine residues vary among TIM50 proteins from different species. In ScTim50, there is only one cysteine residue (C268) located in the presequence-binding groove. The distribution of cysteine residues in C. albicans TIM50 may influence its structural stability and interaction properties .

Functionally, C. albicans TIM50 likely performs the same essential roles in protein import as TIM50 in other fungi, including preprotein recognition in the intermembrane space, transfer to the TIM23 channel, and maintenance of the inner membrane permeability barrier.

What are the key differences between fungal TIM50 and human TIMM50?

Fungal TIM50 proteins, including that from Candida albicans, exhibit several important differences from human TIMM50:

These differences highlight the evolutionary divergence of TIM50 proteins, with human TIMM50 acquiring additional functions while maintaining the core role in mitochondrial protein import.

How has TIM50 evolved across different eukaryotic lineages?

TIM50 shows interesting evolutionary patterns across eukaryotic lineages, with both conserved features and notable adaptations:

  • Core structural and functional conservation: The basic structure of TIM50—a single transmembrane domain with a large IMS-exposed domain—is conserved across diverse eukaryotes, from fungi to mammals and protozoans. This conservation reflects the fundamental importance of TIM50 in mitochondrial protein import .

  • Divergence in trypanosomatids: TIM50 in trypanosomatids like Trypanosoma brucei (TbTim50) shows significant divergence. TbTim50 possesses a weaker TMD (amino acids 285-310) positioned differently compared to other eukaryotes . Despite this unusual TMD position, TbTim50 maintains the same membrane topology (N-in, C-out) as other TIM50 homologs. This suggests evolutionary adaptation while preserving core functionality.

  • Phosphatase domain evolution: The C-terminal phosphatase-like domain shows interesting evolutionary patterns. In fungi, this domain has lost its catalytic activity due to mutations in the DXDX(T/V) motif. In contrast, human TIMM50 and TbTim50 have retained phosphatase activity . This suggests that the phosphatase activity was present in the ancestral TIM50 but was lost in the fungal lineage, where the domain was repurposed for structural functions in preprotein binding.

  • Adaptation to different TIM complexes: TIM50 has adapted to function with somewhat different partner proteins across lineages. For example, T. brucei lacks Tim23 but has TbTim17, which possesses a much shorter hydrophilic N-terminal region compared to ScTim23 . Consequently, the regions in TbTim50 that interact with TbTim17 differ from those in ScTim50 that interact with ScTim23.

  • Functional expansion in multicellular organisms: In more complex multicellular organisms, TIM50 has acquired additional functions beyond protein import. In humans, TIMM50 is involved in apoptosis regulation and has been implicated in various diseases, including cancer and neurological disorders . In plants and zebrafish, Tim50 plays important roles in development and growth .

This evolutionary pattern reflects how a core component of the mitochondrial import machinery has been maintained across eukaryotic evolution while acquiring lineage-specific adaptations and, in some cases, additional functions beyond protein import.

What are common challenges in working with recombinant TIM50 proteins and how can they be addressed?

Working with recombinant TIM50 proteins presents several challenges:

  • Protein solubility and stability issues: As a membrane-associated protein, TIM50 can be prone to aggregation and insolubility.

    • Solution: Express only the soluble IMS domain for interaction studies, or use mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin when working with full-length protein. Adding stabilizers like trehalose (6%) to storage buffers can enhance stability .

  • Maintaining native conformation: Ensuring the recombinant protein adopts its native conformation is crucial for functional studies.

    • Solution: Optimize expression conditions (lower temperature, slower induction), consider expressing in eukaryotic systems for complex proteins, and validate proper folding using circular dichroism or limited proteolysis.

  • Protein degradation during storage: TIM50 may be susceptible to degradation during storage.

    • Solution: Store at -80°C with 5-50% glycerol, avoid repeated freeze-thaw cycles, and aliquot protein solutions immediately after purification . Adding protease inhibitors to storage buffers can also help prevent degradation.

  • Low expression yields: Expression of full-length TIM50 often results in lower yields.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and consider fusion tags that enhance solubility (like MBP or SUMO) in addition to the His-tag used for purification.

  • Protein functionality assessment: Verifying that the recombinant protein retains its native functionality can be challenging.

    • Solution: Develop robust functional assays, such as preprotein binding assays or reconstitution into liposomes for interaction studies with other TIM components.

How can researchers effectively study TIM50 function in Candida albicans given its essential nature?

Studying essential proteins like TIM50 in Candida albicans requires specialized approaches:

  • Conditional expression systems: Employ tetracycline-regulated or other inducible promoter systems to control TIM50 expression levels. This allows for gradual depletion of the protein while monitoring cellular effects.

  • Domain complementation approaches: Similar to the approach used in yeast, express different domains of TIM50 separately to study their individual contributions to function . This can reveal which parts of the protein are essential for viability.

  • Partial knockdown using RNAi or CRISPR interference: In systems where complete knockout is lethal, partial knockdown can reveal phenotypes while maintaining sufficient function for viability.

  • Heterologous complementation: Express Candida albicans TIM50 in other fungal species (like S. cerevisiae) where the endogenous TIM50 has been depleted, to assess functional conservation and unique features.

  • Temperature-sensitive mutants: Generate temperature-sensitive TIM50 mutants that function normally at permissive temperatures but lose function at restrictive temperatures, allowing for temporal control of protein function.

  • Split protein approach: As demonstrated with yeast TIM50, express the protein as separate domains in trans to determine if this approach preserves function in C. albicans as well . This can provide insights into domain interactions and functions.

  • Chemical genetics: Use small molecule inhibitors that target specific aspects of mitochondrial import to bypass the need for genetic manipulation of TIM50 directly.

These approaches can be combined with comprehensive phenotypic analyses, including mitochondrial morphology assessment, membrane potential measurements, and protein import assays to characterize TIM50 function in Candida albicans.

What strategies can be used to investigate the specific role of TIM50 in Candida albicans pathogenicity?

Investigating TIM50's role in Candida albicans pathogenicity requires approaches that link mitochondrial function to virulence:

  • Controlled expression during infection models: Use conditional promoters to modulate TIM50 expression levels during infection in various host models (cell culture, Galleria mellonella, or murine models). This allows for assessment of how TIM50 function affects virulence without completely eliminating viability.

  • Domain-specific mutations: Introduce targeted mutations in specific functional domains of TIM50 (phosphatase-like domain, preprotein-binding region) to assess their impact on both mitochondrial function and virulence traits.

  • Stress response analysis: Examine how TIM50 depletion or mutation affects C. albicans response to host-relevant stresses (oxidative stress, nitrosative stress, pH fluctuations, nutrient limitation) that require mitochondrial adaptation.

  • Hyphal morphogenesis assessment: Since the yeast-to-hyphal transition is critical for C. albicans virulence and is influenced by mitochondrial function, assess how TIM50 alterations affect morphological switching under host-relevant conditions.

  • Metabolic profiling: Perform metabolomic analysis of TIM50-depleted or mutant C. albicans strains to identify metabolic alterations that might impact virulence traits.

  • Biofilm formation analysis: Investigate how TIM50 function affects biofilm formation, a key virulence determinant that requires metabolic adaptation and stress response.

  • Host cell interaction studies: Assess how TIM50 alterations affect C. albicans interactions with host immune cells, including phagocytosis resistance, immune cell activation, and escape from immune killing.

  • Comparative analysis with non-pathogenic yeasts: Compare the effects of similar TIM50 manipulations in C. albicans versus non-pathogenic yeasts to identify pathogen-specific functions.

These approaches can help elucidate how this essential component of mitochondrial protein import contributes to the pathogenic lifestyle of Candida albicans, potentially revealing new targets for antifungal intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.