Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes if you have specific requirements. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TIM54; CAALFM_C703120WA; CaJ7.0359; CaO19.12608; CaO19.5143; Mitochondrial import inner membrane translocase subunit TIM54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
TIM54
Target Protein Sequence
MPDANEVKPKKGWSNPALRMMGIPRISLPSRNWMIFWTVVTTIGGGIAYDKYEQKQMRKK WMDAVKQFGEVSYGANEIPRKLSIFIAPPPNDFLDESLKLFRKFIKPVLNAGVVDFEIFS ESRQGDIRASVAEKIRELRRKQLVEETPKKNESNGNQDNDEEELKSRSDLYKAKDVLGLY KVFPADINVKSEDAIDDSSAGGIICVGRGAYKEYLSGVHEGLLGPLEKPQSVIDEETKLA EEKKKEKEENPDKDDDNDEEQSNLKPVPLRYIQPEDYANAQLAPELDLSTVVKDDKGVPV FFEQPVYTFPLPNLVGFTNIPRKIYRYFTKRFLVDDFGERTATIVNNKSRPFVYKDVLMA KEEEMDWPKKWVEKGKERNSEWVQELEHDERVTSRMKVFE
Uniprot No.

Target Background

Function
Recombinant *Candida albicans* Mitochondrial import inner membrane translocase subunit TIM54 (TIM54) is an essential component of the TIM22 complex. This complex mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex functions as a twin-pore translocase, utilizing the membrane potential as its driving force.
Database Links
Protein Families
TIM54 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure and localization of Tim54p in Candida albicans?

Tim54p in Candida albicans is a 400-amino acid mitochondrial protein localized in the inner membrane (IM). Based on structural analyses across related species, Tim54p is an integral membrane protein that likely contains one or two potential membrane-spanning segments (residues 37-54 and 358-386 in S. cerevisiae homolog) . The carboxyl terminus of Tim54p faces the intermembrane space (IMS), as demonstrated through protease protection assays in yeast models . The protein possesses a hydropathy profile suggesting transmembrane domains, though unlike many matrix-targeted proteins, Tim54p does not contain a cleavable N-terminal presequence .

What is the primary function of Tim54p in mitochondrial protein import?

Tim54p functions as an essential component of the translocase of the inner mitochondrial membrane (TIM) complex, specifically the TIM22 complex. While it was initially thought to directly participate in protein translocation, research indicates that Tim54p primarily serves as a scaffolding/assembly factor for the TIM22 complex rather than directly binding to substrate proteins . The protein plays a critical role in the insertion of polytopic proteins into the inner membrane but is not required for the translocation of precursors into the matrix . Studies in yeast have demonstrated that Tim54p works in coordination with Tim22p, with multiple copies of the TIM22 gene suppressing growth defects in tim54-1 temperature-sensitive mutants .

What are effective methods for isolating functional recombinant C. albicans Tim54p?

For isolating functional recombinant C. albicans Tim54p, researchers typically employ E. coli expression systems with N-terminal histidine tags (His-tags) . The full-length protein (amino acids 1-400) can be expressed and purified using metal affinity chromatography. To maintain protein stability, it's crucial to store the purified protein in Tris-based buffer with 50% glycerol at -20°C or -80°C . For working solutions, aliquot the protein and avoid repeated freeze-thaw cycles, as this significantly reduces activity . Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and for long-term storage, addition of 5-50% glycerol is recommended .

How can researchers assess Tim54p interactions with other TIM complex components?

Several complementary approaches have proven effective for studying Tim54p interactions:

  • Co-immunoprecipitation assays: Detergent-solubilized mitochondria can be used to identify interactions between Tim54p and other components. In yeast models, Tim22p was successfully co-precipitated with Tim54p, demonstrating their physical interaction .

  • Tandem affinity purification: This technique has been used to identify Tim54p as a component of the TIM complex in T. brucei, revealing its association with TbTim17 .

  • Two-hybrid screening: Originally, Tim54p in yeast was identified through a two-hybrid interaction with the outer membrane protein Mmm1p, indicating potential cross-membrane connections .

  • Direct binding assays: In vitro binding studies with purified components can determine direct interactions. In T. brucei, TbTim54 was shown to interact directly with small TIM chaperones (TbTim11 and TbTim13) and the N-terminal domain of TbTim17 .

What methodological approaches are most effective for studying Tim54p's role in mitochondrial protein import?

To elucidate Tim54p's role in mitochondrial protein import, researchers should employ a multi-faceted approach:

  • In vitro import assays: Using isolated mitochondria and radiolabeled precursor proteins to measure import efficiency in the presence or absence of functional Tim54p .

  • Genetic depletion studies: RNAi knockdown or conditional mutants can reveal the impact of Tim54p reduction on specific import pathways . This approach has demonstrated differential effects on the import of various mitochondrial proteins.

  • Complementation studies: Overexpression of Tim54p or related proteins (e.g., Tim22p) can determine functional relationships and rescue phenotypes .

  • Protease protection assays: These assays help determine protein topology and the submitochondrial localization of imported proteins .

  • Blue Native PAGE: This technique allows visualization of protein complexes and can reveal the integrity of the TIM22 complex in the absence of Tim54p .

How conserved is Tim54p structure and function across different fungal species?

Tim54p shows variable conservation across fungal species. While homologs exist between Saccharomyces cerevisiae and Candida albicans, sequence comparison reveals limited homology to proteins in other organisms . Analysis of the S. cerevisiae Tim54p sequence identified a potential cognate in C. albicans, but no other significant homologies in available databases at the time of initial characterization . The protein contains a region (amino acids 133-154 in S. cerevisiae) predicted to form a coiled-coil structure, which may be important for protein-protein interactions . Despite sequence divergence, the functional role in mitochondrial protein import appears to be conserved, as both proteins are components of inner membrane translocase complexes involved in protein insertion.

How does Trypanosoma brucei Tim54 differ from its fungal counterparts?

Trypanosoma brucei Tim54 (TbTim54) exhibits significant differences from its fungal counterparts:

  • Localization differences: While fungal Tim54p is an integral inner membrane protein, TbTim54 is a trypanosome-specific IMS protein that is peripherally associated with the inner membrane .

  • Complex association: TbTim54 is present in a protein complex slightly larger than the TbTim17 complex, suggesting a different structural organization compared to the fungal TIM22 complex .

  • Substrate specificity: TbTim54 appears to have substrate specificity for internal signal-containing mitochondrial proteins, particularly mitochondrial carrier proteins (MCPs). This specificity differs from that observed in fungal systems .

  • Small TIM interactions: TbTim54 directly interacts with small TIM chaperones (TbTim11 and TbTim13), indicating a unique role in the import pathway of T. brucei .

These differences highlight the evolutionary divergence of the mitochondrial import machinery across eukaryotic lineages, with specialized adaptations in the trypanosome system.

What is the relationship between Tim54p and the TIM22 complex assembly?

Tim54p plays a critical role in the stability and assembly of the TIM22 complex:

  • Scaffolding function: Tim54p serves as a scaffolding/assembly factor for the 300-kD TIM22 complex rather than directly mediating substrate import .

  • Complex integrity: In yeast strains with Tim54p mutations, the TIM22 complex becomes destabilized, demonstrating its structural importance .

  • Tim22p interaction: Tim54p directly interacts with Tim22p, the central component of the TIM22 complex. This interaction is essential for proper complex assembly and function .

  • Genetic interaction: Overexpression of Tim22p can partially suppress growth defects in temperature-sensitive tim54 mutants (tim54-3), but not in complete deletion mutants (Δtim54), indicating that even minimal amounts of Tim54p are required for TIM22 complex function .

These interactions collectively establish Tim54p as an essential structural component that maintains the integrity of the TIM22 complex, thereby facilitating the import of inner membrane proteins.

What is the relationship between Tim54p and Yme1p assembly?

Tim54p has a second independent function beyond its role in the TIM22 complex - it is required for the assembly of Yme1p into a proteolytically active complex:

  • Yme1p function: Yme1p is an ATP-dependent metalloprotease located in the mitochondrial inner membrane, responsible for protein quality control and turnover .

  • Assembly pathway: Although Yme1p is imported through the TIM23 pathway (not the TIM22 pathway), Tim54p is specifically required for its assembly into an active complex after import .

  • Petite-negative phenotype: The inability to assemble functional Yme1p complexes in tim54 mutants is likely the major factor contributing to the petite-negative phenotype (inability to lose mitochondrial DNA) observed in these strains .

  • Functional link: This relationship represents a novel collaborative effort between the two translocons (TIM22 and TIM23) of the inner membrane, with Tim54p effectively linking pathways of import, assembly, and protein turnover in the mitochondrion .

How might Tim54p function in C. albicans relate to its pathogenicity?

While direct evidence linking Tim54p to C. albicans pathogenicity is limited in the provided search results, several hypotheses can be formulated based on the protein's function:

  • Metabolic adaptation: As a component of the mitochondrial import machinery, Tim54p likely influences the ability of C. albicans to adapt to different metabolic environments encountered during infection. Mitochondrial function is crucial for stress adaptation in pathogenic fungi.

  • Morphogenetic switching: C. albicans pathogenicity depends on its ability to transition between yeast and hyphal forms. Mitochondrial function has been implicated in this morphogenetic switching, suggesting Tim54p may indirectly influence virulence through its effects on mitochondrial protein composition.

  • Stress response: Proper mitochondrial function is essential for responding to host-induced stresses, including oxidative stress from immune cells. Tim54p's role in maintaining mitochondrial proteostasis could be critical for stress tolerance during infection.

  • Drug target potential: Given that Tim54p is essential in S. cerevisiae and has a unique structure compared to human mitochondrial import components, it could represent a potential antifungal drug target if similarly essential in C. albicans.

Future research should investigate these hypotheses through conditional mutations or regulated expression of TIM54 in infection models.

What are the technical challenges in studying TIM complex dynamics using recombinant Tim54p?

Researchers face several significant challenges when studying TIM complex dynamics with recombinant Tim54p:

  • Membrane protein reconstitution: As an integral membrane protein, Tim54p requires careful reconstitution into lipid environments that mimic the mitochondrial inner membrane to maintain native conformation and function .

  • Complex assembly in vitro: The TIM22 complex contains multiple subunits beyond Tim54p. Reconstituting the complete functional complex requires co-expression or co-reconstitution of multiple components in proper stoichiometry.

  • Post-translational modifications: Potential modifications in the native mitochondrial environment may be absent in recombinant systems, affecting protein interactions and function.

  • Functional assays: Developing assays that accurately measure the scaffolding/assembly function of Tim54p rather than direct substrate interaction presents methodological challenges.

  • Species-specific differences: Extrapolating findings from model systems (S. cerevisiae, T. brucei) to C. albicans requires careful validation, as functional differences exist even between related species .

To address these challenges, researchers should consider complementary approaches, including in organello assays with isolated mitochondria, in vivo studies using conditional mutants, and advanced structural biology techniques like cryo-electron microscopy to resolve complex architecture.

How can researchers utilize recombinant Tim54p to study mitochondrial import pathways?

Recombinant Tim54p can serve as a valuable tool for studying mitochondrial import pathways through several approaches:

  • Competitive inhibition studies: Purified recombinant Tim54p can be used to compete with native Tim54p for binding partners, potentially disrupting specific interactions within the import pathway.

  • Reconstitution experiments: Depleted mitochondria or liposomes can be supplemented with recombinant Tim54p to restore specific functions, allowing detailed structure-function analyses.

  • Interaction mapping: Recombinant fragments of Tim54p can help identify minimal binding domains required for interactions with other TIM complex components or substrate proteins.

  • Cross-linking studies: Modified recombinant Tim54p with photo-activatable cross-linkers can capture transient interactions during the import process.

  • Structural studies: Purified Tim54p, alone or in complex with binding partners, can be subjected to structural analyses to understand the molecular basis of its scaffolding function.

These approaches can provide mechanistic insights into the distinct roles of Tim54p in protein import and complex assembly.

What experimental approaches could resolve contradictory findings regarding Tim54p's direct role in protein import?

To resolve contradictions regarding Tim54p's direct role in protein import, researchers should implement:

  • Site-specific crosslinking: Using recombinant Tim54p with site-specific crosslinkers to capture transient interactions with translocating substrates at different stages of import.

  • Single-molecule techniques: Fluorescence resonance energy transfer (FRET) or other single-molecule approaches can detect direct, potentially transient interactions between Tim54p and substrate proteins during import.

  • Reconstitution of minimal import systems: Building bottom-up systems with defined components to determine the minimal requirements for membrane protein insertion with and without Tim54p.

  • Chimeric protein approaches: Creating fusion proteins between Tim54p and known import components (e.g., Tim22p) to test which domains contribute to direct substrate interactions versus scaffolding functions.

  • Comparative analysis across species: Systematic comparison of Tim54p function in S. cerevisiae, C. albicans, and T. brucei can illuminate conserved mechanisms versus species-specific adaptations .

  • Targeted mutagenesis: Creating specific mutations in predicted substrate-binding regions versus scaffold regions to separately assess these functions.

By combining these approaches, researchers can distinguish between direct substrate interactions and indirect effects through complex assembly, resolving apparent contradictions in the literature.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.