Recombinant Candida albicans Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Candida albicans Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) is a protein component of the i-AAA protease complex found in the inner mitochondrial membrane of the yeast Candida albicans . MGR1 plays a crucial role in degrading misfolded proteins within the mitochondria, thus maintaining mitochondrial protein homeostasis .

Basic Information:

  • Protein Name: Mitochondrial inner membrane i-AAA protease complex subunit MGR1

  • Gene Name: MGR1

  • ORF Names: CaO19.8493, CaO19.874

  • Species: Candida albicans (strain SC5314 / ATCC MYA-2876)

  • UniProt Accession Number: Q5AHC2

  • Sequence Length: 368 amino acids

  • Molecular Weight: Approximately 40-45 kDa (depending on post-translational modifications and expression system)

Functional Aspects

MGR1 functions as a critical component of the i-AAA protease complex, which is essential for mitochondrial protein quality control .

Post-translational Modifications

Candida albicans is enriched with highly glycosylated mannoproteins that are involved in the interaction with host tissues . N- and O-glycosylation are post-translational modifications that initiate in the endoplasmic reticulum and finalize in the Golgi .

Role in Pathogenicity of Candida albicans

Candida albicans can adapt its growth to a range of environmental changes by modulation of expression of many genes in a coordinated manner .

  • Cell Wall Integrity: MGR1 may indirectly influence cell wall integrity through its effects on mitochondrial function and cellular stress responses .

  • Biofilm Formation: Mig1 and Mig2 are together required for the abilities to form hyphae and biofilm .

  • Drug Resistance: Mdr1 protein invariably contributes to an increased efflux of commonly used azoles and thus corroborates their direct involvement in MDR in Candida albicans .

Expression and Regulation

  • Expression Conditions: The expression of MGR1 can be influenced by various environmental conditions and cellular stresses.

  • Transcriptional Regulation: Transcription factors such as RLM1, Mig1, and Mig2 are key regulators in Candida albicans . RLM1 is one of the putative transcription factors involved in the cell wall integrity pathway . Mig1 and Mig2 are transcription factors and mediators of glucose repression in C. albicans .

Homologues and Interactions

  • Homologues: MGR1 has homologues in other yeast species, such as Saccharomyces cerevisiae, where it is also involved in mitochondrial protein quality control .

  • Protein-Protein Interactions: MGR1 interacts with other subunits of the i-AAA protease complex, forming a functional proteolytic unit.

Research Techniques

  • Recombinant Expression: MGR1 can be produced in various expression systems such as Pichia pastoris .

  • Gene Deletion/Mutation: Mutants of MGR1 showed typical cell wall weakening phenotypes, such as hypersensitivity to Congo Red, Calcofluor White, and caspofungin .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MGR1; CAALFM_C203460CA; CaO19.8493; CaO19.874; Mitochondrial inner membrane i-AAA protease complex subunit MGR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
MGR1
Target Protein Sequence
MGVYIPPPNDKDDGDKKKQDTNSNTNQPTPPSSSSPSGSTTIYIPNPASSIPRNPKVGLI WGPLTPASDNLPALYSMIGLQFVIGCGFFKYARTLSRLRPIGGFQQQPHAHMAPKLVRTG PIWKIALSVITGSALSFGSGLELCRVTLPYDPWYDEAQHYRRMAVKNGDKPSSWFGAYRY YKPMDFKTWIDKVGDWIENVEKEIKIDDPANFANLSLELGKNSNVINVQRQPQTSGGILN KLNNKGKYLEIYTKLNENNTKRWEKLLHEDLNEVTELNKAPRLDLILEGKSDLINPEFTK SAIILGNHTMDDDDQFEMVWLNFEPWDELKLDTEYDIRLVPSYAGATEEIENEDQESPLT DNVVAKQT
Uniprot No.

Target Background

Function
A component of the mitochondrial inner membrane i-AAA protease complex; essential for the turnover of mitochondrial inner membrane proteins.
Database Links
Protein Families
MGR1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the mitochondrial i-AAA protease complex in C. albicans and what role does MGR1 play in it?

The i-AAA protease complex is a conserved mitochondrial inner membrane-anchored proteolytic system that degrades misfolded or damaged proteins, with its active site facing the intermembrane space. In fungi like C. albicans, MGR1 functions as an accessory subunit of this complex, likely involved in substrate recognition and complex stability.

Based on studies in S. cerevisiae, MGR1 is crucial for proper assembly of the i-AAA protease complex. Mitochondria lacking MGR1 contain misassembled i-AAA proteases and show defects in the turnover of inner membrane proteins . The complex typically consists of a core hexameric ring of AAA-ATPase subunits with associated accessory proteins like MGR1 that help coordinate substrate recognition and processing.

Unlike the core catalytic subunits that contain the proteolytic domains, MGR1 likely serves as an adaptor protein that helps recruit specific substrates to the complex and may stabilize protein-protein interactions within the assembled complex. This organization allows for efficient protein quality control in the mitochondrial inner membrane.

How does MGR1 contribute to mitochondrial function in C. albicans?

MGR1 contributes to mitochondrial function primarily through its role in protein quality control. By facilitating the degradation of damaged or misfolded proteins in the inner membrane, MGR1 helps maintain mitochondrial proteostasis and integrity. This function is particularly critical under stress conditions that can lead to protein damage.

Research in S. cerevisiae indicates that MGR1 becomes essential for cell viability in the absence of mitochondrial DNA (mtDNA) . This suggests that MGR1-mediated protein quality control is especially important when mitochondrial function is compromised. In a pathogen like C. albicans, which can survive with dysfunctional mitochondria during host adaptation, MGR1 may provide a crucial survival advantage.

Additionally, proper mitochondrial function influences numerous cellular processes including energy metabolism, calcium homeostasis, reactive oxygen species (ROS) production, and apoptosis - all of which can impact C. albicans virulence and stress adaptation. Through its effects on mitochondrial proteostasis, MGR1 likely influences these broader cellular functions.

What is known about the genomic organization and expression patterns of MGR1 in C. albicans?

While specific information about MGR1 expression patterns in C. albicans is limited in the provided search results, we can infer several aspects based on knowledge of mitochondrial genes and comparison with related fungi.

MGR1 is likely nuclear-encoded (rather than mitochondrially encoded) and its expression is probably responsive to mitochondrial stress signals and metabolic cues. Expression may be coordinated with other mitochondrial quality control components to ensure balanced proteostasis.

In S. cerevisiae, MGR1 was identified through a genome-wide screen for genes required for growth in the absence of mitochondrial DNA . This suggests its expression becomes particularly important under conditions of mitochondrial stress. Similar expression patterns might exist in C. albicans, particularly during adaptation to host environments or exposure to antifungal agents that affect mitochondrial function.

How can MGR1 function be studied in the context of C. albicans pathogenicity?

Studying MGR1's role in C. albicans pathogenicity requires a multi-faceted approach combining genetic manipulation, functional assays, and infection models. The following methodological framework would be appropriate:

First, generate MGR1 deletion mutants (mgr1Δ) using CRISPR-Cas9 or traditional homologous recombination approaches similar to those employed for other C. albicans genes . Complemented strains expressing wild-type MGR1 should be created as controls to verify phenotypes are specifically due to MGR1 loss.

Next, assess virulence-related phenotypes in these strains:

  • Filamentation assays under various inducing conditions

  • Biofilm formation capacity on different substrates

  • Stress resistance (oxidative, nitrosative, pH, etc.)

  • Metabolic flexibility using different carbon sources

For in vivo relevance, evaluate colonization capacity in murine models. Similar to studies with other regulatory genes like DIG1, gastrointestinal tract colonization assays can reveal whether MGR1 affects commensalism . Systemic infection models would determine if MGR1 influences invasive disease progression.

Additionally, examine if MGR1 deletion affects antifungal susceptibility, particularly to drugs targeting mitochondrial function or membrane integrity. This could reveal whether MGR1-dependent proteostasis contributes to drug tolerance mechanisms.

What experimental approaches can be used to identify MGR1 interacting partners and substrates?

Identifying MGR1 interacting partners and substrates requires specialized approaches for membrane proteins:

Interactome Analysis:

  • Epitope-tag MGR1 with a tag suitable for immunoprecipitation (HA, FLAG, or TAP tag)

  • Solubilize mitochondrial membranes using gentle detergents (digitonin, DDM)

  • Perform co-immunoprecipitation followed by mass spectrometry

  • Validate interactions using reciprocal pull-downs or fluorescence microscopy

Substrate Identification:

  • Compare the mitochondrial proteome between wild-type and mgr1Δ strains using quantitative proteomics

  • Look for proteins that accumulate in the mutant, indicating impaired degradation

  • Perform pulse-chase experiments with radiolabeled amino acids to track protein turnover rates

  • Use proximity labeling approaches (BioID or APEX) with MGR1 as the bait to identify nearby proteins

A substrate trapping approach can also be employed: generate a catalytically inactive i-AAA protease complex that can bind but not degrade substrates, then identify trapped proteins. This might require manipulation of the catalytic core subunits rather than MGR1 itself.

The table below summarizes potential methods for studying MGR1 interactions:

MethodAdvantageLimitationBest for detecting
Co-IP/MSCaptures stable interactionsMay miss transient interactionsCore complex components
BioID/APEXCaptures proximity regardless of interaction strengthNon-specific labelingTransient substrates
Crosslinking-MSPreserves in vivo interactionsComplex data analysisStructural relationships
Proteomics comparisonUnbiased screen for substratesIndirect evidenceAccumulated substrates
Split-fluorescent proteinsVisualize interactions in vivoMay affect protein functionSpatial organization

How does MGR1 function relate to mitochondrial DNA maintenance in C. albicans?

The relationship between MGR1 and mitochondrial DNA (mtDNA) maintenance in C. albicans likely mirrors findings in S. cerevisiae, where MGR1 was identified as essential for growth in cells lacking mtDNA . This suggests a complex relationship that can be investigated using several approaches:

Create petite-negative screens in C. albicans by treating cells with ethidium bromide to deplete mtDNA, then assess viability of mgr1Δ mutants compared to wild-type. If MGR1 is required for growth without mtDNA, the mutants should show significantly reduced viability.

Analyze mtDNA stability by measuring mtDNA copy number and integrity in wild-type versus mgr1Δ strains under normal and stress conditions. Quantitative PCR targeting multiple mtDNA regions can assess both copy number and integrity.

Examine mitochondrial nucleoid organization using fluorescence microscopy with DNA-binding dyes or tagged nucleoid proteins. Disrupted nucleoid structure in mgr1Δ mutants would suggest a role in mtDNA organization.

The connection may be indirect: MGR1's role in protein quality control might affect proteins involved in mtDNA replication, transcription, or packaging. Proteomic analysis focusing on nucleoid-associated proteins could reveal if their abundance or modification state changes in mgr1Δ mutants.

Additionally, metabolic profiling of mgr1Δ strains would determine if the mutants show altered respiratory capacity or compensatory metabolic adaptations that might explain the petite-negative phenotype observed in S. cerevisiae.

How conserved is MGR1 across fungal species, particularly between C. albicans and S. cerevisiae?

MGR1 appears to be a conserved component of the mitochondrial i-AAA protease complex across fungi, though with potential species-specific adaptations. A comprehensive analysis would include:

Sequence alignment reveals conserved domains and motifs, particularly in regions mediating interactions with core i-AAA protease subunits. The transmembrane domains anchoring MGR1 to the inner membrane are likely highly conserved, while substrate recognition regions might show more variation reflecting species-specific targets.

Functional conservation can be tested through cross-species complementation experiments. Expressing C. albicans MGR1 in S. cerevisiae mgr1Δ mutants would determine if it rescues the petite-negative phenotype .

Evolutionary rate analysis comparing synonymous versus non-synonymous substitution rates across different fungal lineages would reveal if MGR1 is under purifying selection (high conservation) or positive selection (adaptation).

Interestingly, while the i-AAA protease complex is broadly conserved, its accessory components might show more variation between pathogenic and non-pathogenic fungi. This could reflect adaptations to different ecological niches and metabolic requirements.

From available data on other mitochondrial proteins in C. albicans, we can infer that MGR1 likely retains core functions from S. cerevisiae but may have acquired additional roles related to pathogenesis or stress adaptation in the human host environment.

What are the unique features of C. albicans MGR1 compared to homologs in non-pathogenic fungi?

While specific structural information about C. albicans MGR1 is limited in the provided search results, several hypotheses about its unique features can be formulated based on C. albicans biology:

As a human pathogen, C. albicans faces unique stresses including host immune defenses, fluctuating nutrient availability, and antifungal exposure. MGR1 in C. albicans might show adaptations for functioning under these stress conditions, potentially including:

  • Modified substrate specificity that prioritizes degradation of proteins damaged by host-generated reactive oxygen or nitrogen species

  • Enhanced stability under fluctuating pH conditions encountered during host colonization

  • Altered regulation that integrates with C. albicans-specific stress response pathways

C. albicans is known for its metabolic flexibility, including the ability to utilize diverse carbon sources and survive in both aerobic and hypoxic environments. MGR1 may have adapted to support mitochondrial function across these diverse metabolic states.

Structural predictions could reveal unique domains or motifs in C. albicans MGR1 that might mediate species-specific interactions. Furthermore, analysis of gene expression patterns could show if MGR1 regulation differs between C. albicans and non-pathogenic fungi, particularly during morphological transitions (yeast-to-hyphal switching) that are critical for virulence.

Experimental validation of these differences would require comparative functional studies between MGR1 proteins from multiple fungal species under identical conditions.

What are the optimal methods for recombinant expression and purification of C. albicans MGR1?

Recombinant expression and purification of C. albicans MGR1 presents challenges typical of membrane proteins. A systematic approach involves:

Expression System Selection:
The optimal expression system depends on downstream applications. For structural studies requiring high yields, insect cell (Sf9/Hi5) or yeast (Pichia pastoris) expression systems are preferable as they provide eukaryotic post-translational modifications and membrane insertion machinery. For simple interaction studies, bacterial expression (E. coli) of soluble domains might suffice.

Construct Design Considerations:

  • Include an N- or C-terminal affinity tag (His6, FLAG, etc.) for purification

  • Consider removing predicted disordered regions that might impede crystallization

  • For difficult full-length expression, identify functional domains for truncated constructs

  • Optimize codon usage for the chosen expression system

Solubilization and Purification Strategy:
As a membrane protein, MGR1 requires careful solubilization from membranes. Test a panel of detergents (DDM, LMNG, GDN) for optimal extraction while maintaining native structure. Alternatively, consider using styrene-maleic acid copolymer (SMA) to extract MGR1 in native lipid nanodiscs.

Purification typically involves:

  • Affinity chromatography using the engineered tag

  • Size exclusion chromatography to remove aggregates

  • Optional ion exchange step for higher purity

Functional Validation:
Verify that recombinant MGR1 retains its native function through:

  • Binding assays with known interaction partners

  • Reconstitution into proteoliposomes for functional studies

  • Circular dichroism to confirm proper folding

For structural studies, consider reconstituting MGR1 with core i-AAA protease subunits to obtain the complete complex, which may enhance stability and provide biological relevance.

What techniques are most effective for studying MGR1's role in mitochondrial protein degradation?

Investigating MGR1's role in mitochondrial protein degradation requires both in vivo and in vitro approaches:

In Vivo Degradation Assays:

  • Generate reporter substrates known to be degraded by the i-AAA protease and express them in wild-type and mgr1Δ strains

  • Monitor substrate levels using Western blotting or fluorescence microscopy

  • Perform cycloheximide chase experiments to track protein degradation kinetics

  • Use temperature-sensitive alleles of substrate proteins to trigger misfolding and monitor clearance rates

In Vitro Reconstitution:

  • Purify the i-AAA protease complex with and without MGR1

  • Assess proteolytic activity using fluorogenic peptide substrates

  • Compare degradation efficiencies for model substrates

  • Analyze how MGR1 affects substrate recognition and processing using pre-steady-state kinetics

Structural Approaches:
Cryo-electron microscopy of the i-AAA protease complex with and without MGR1 can reveal how MGR1 influences complex architecture and substrate engagement channels.

Substrate Profiling:
Compare the mitochondrial proteome between wild-type and mgr1Δ strains using quantitative proteomics (SILAC or TMT labeling). Proteins that accumulate in the mutant represent potential MGR1-dependent substrates.

The following table summarizes approaches to monitor protein degradation:

TechniqueTime ResolutionThroughputInformation Gained
Cycloheximide chaseHoursLow-mediumHalf-life of specific proteins
Fluorescent timersMinutes-hoursHighSpatial degradation patterns
SILAC pulse-chaseHoursHighGlobal degradation rates
In vitro degradationSeconds-minutesLowDirect enzymatic parameters
BioID proximity labelingN/AHighSubstrate capture during processing

How can researchers investigate the impact of MGR1 on C. albicans drug resistance?

Investigating MGR1's potential impact on drug resistance in C. albicans requires a multifaceted approach that explores both direct and indirect mechanisms:

Susceptibility Testing:
Perform standardized antifungal susceptibility testing (CLSI or EUCAST methods) comparing wild-type, mgr1Δ, and MGR1-complemented strains against:

  • Azoles (fluconazole, voriconazole)

  • Polyenes (amphotericin B)

  • Echinocandins (caspofungin)

  • Mitochondrial-targeting compounds (terbinafine)

This would establish if MGR1 deletion alters minimum inhibitory concentrations (MICs) for different drug classes.

Drug Resistance Evolution:
Perform in vitro evolution experiments exposing wild-type and mgr1Δ strains to increasing concentrations of antifungals. Compare:

  • Rate of resistance acquisition

  • Stability of resistant phenotypes

  • Molecular mechanisms of acquired resistance

  • Fitness costs of resistance

Interaction with Known Resistance Mechanisms:
Generate double mutants combining mgr1Δ with mutations in known resistance genes, such as:

  • MRR1, which controls expression of the MDR1 efflux pump

  • MIG1, which confers resistance against weak organic acids

  • CDR1, involved in azole resistance

Epistasis analysis would reveal if MGR1 functions in the same or parallel pathways as these established resistance factors.

Mechanistic Studies:
Investigate specific mechanisms by which MGR1 might influence drug resistance:

  • Measure membrane potential and drug accumulation using fluorescent dyes

  • Assess mitochondrial fitness and respiration capacity

  • Monitor reactive oxygen species production with and without drug exposure

  • Analyze expression of stress response pathways in mgr1Δ strains

While direct evidence linking MGR1 to drug resistance in C. albicans is not presented in the search results, its role in mitochondrial proteostasis suggests it could influence cellular responses to drug-induced stress, particularly for compounds that affect mitochondrial function or trigger oxidative damage.

What are the most promising research directions for understanding MGR1's role in C. albicans biology?

Several high-priority research directions would significantly advance our understanding of MGR1's role in C. albicans biology:

Integration with Metabolic Adaptation:
Investigate how MGR1-dependent protein quality control influences C. albicans' remarkable metabolic flexibility. This would involve characterizing mitochondrial function in mgr1Δ strains under different nutrient conditions and oxygen tensions that mimic host environments. Particular attention should be given to the glyoxylate cycle and fatty acid metabolism, which are important for virulence.

Host-Pathogen Interactions:
Determine if MGR1 contributes to C. albicans survival during phagocytosis by innate immune cells. Macrophages and neutrophils create hostile environments with oxidative and nitrosative stress that could damage mitochondrial proteins, potentially making MGR1-mediated quality control essential for survival.

Biofilm Formation:
Assess if MGR1 influences biofilm development and architecture, given that biofilms involve significant metabolic remodeling. Similar to findings with DIG1, where deletion affected both filamentous growth and gastrointestinal tract colonization , MGR1 might influence both cellular morphology and community behavior.

Stress Signaling Pathways:
Explore how mitochondrial proteostasis connects to nuclear gene expression through retrograde signaling pathways. Comparative transcriptomics between wild-type and mgr1Δ strains under various stresses could reveal if MGR1 status influences broader cellular responses.

Genetic Interaction Networks:
Perform systematic genetic interaction screening using CRISPR-Cas9 technology to identify synthetic lethal or synthetic sick interactions with MGR1. This would position MGR1 within the broader functional landscape of C. albicans biology.

These directions would collectively provide a comprehensive understanding of how this seemingly specialized mitochondrial protein quality control factor might influence broader aspects of C. albicans pathobiology.

What technological advances could enhance our ability to study MGR1 function in C. albicans?

Several emerging technologies could significantly advance our understanding of MGR1 function in C. albicans:

Advanced Imaging Techniques:

  • Super-resolution microscopy (STORM, PALM) to visualize MGR1 distribution within mitochondria at nanometer resolution

  • Live-cell imaging with split fluorescent proteins to capture dynamic interactions

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural features

  • Expansion microscopy to physically enlarge specimens for improved resolution of mitochondrial subcompartments

Single-Cell Technologies:

  • Single-cell RNA-seq to capture heterogeneity in responses to MGR1 deletion

  • Mass cytometry (CyTOF) with mitochondrial markers to profile population-level variations

  • Microfluidic devices for long-term tracking of individual cells and their lineages

Structural Biology Advances:

  • Cryo-electron tomography of mitochondria to visualize the i-AAA protease complex in situ

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein interactions

  • Integrative structural biology combining multiple data types for complete complex modeling

Genome Engineering:

  • Inducible degradation systems (AID, dTAG) for temporal control of MGR1 levels

  • Base editing for introducing specific point mutations without double-strand breaks

  • CRISPRi/CRISPRa for tunable repression or activation of MGR1 expression

Proteomics Advances:

  • Thermal proteome profiling to identify proteins stabilized by MGR1 interactions

  • Limited proteolysis coupled with mass spectrometry (LiP-MS) to detect conformational changes

  • Crosslinking mass spectrometry for mapping interaction interfaces

These technologies would collectively provide unprecedented insights into MGR1 function, overcoming current limitations in studying mitochondrial membrane proteins in fungal pathogens. Particularly valuable would be approaches that maintain native context and capture dynamic processes in living cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.