Recombinant Candida albicans Mitochondrial inner membrane magnesium transporter LPE10 (LPE10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LPE10; CAALFM_C602150CA; CaO19.10959; CaO19.3455; Mitochondrial inner membrane magnesium transporter LPE10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-453
Protein Length
Full Length of Mature Protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
LPE10
Target Protein Sequence
LFLRQLNKKSKPNPHKNKNFDSFNEVFIHKTLLSSINQHNDTDYVRCSIFNANGDMIQHG KEILKSQFIKRYNLTPRDFRKFNWQRSATGTTTSSSSSSSSAGQTSSGTSKSSSLSSSSS SPHSTISALSLSNSSLGSSTNVDIVPNITIRRNSILVQLLNIRALINHDQLIIFDNSSSF QNSHVSSYTHSQFLKDLSQRLKSTNLDGLPFEFKALEGILIYIVSNLNMEMKVHNTVLQN IITGLEDSIDRNKLRYLLIESKKIHQFHRKITLIKNCLEDLLENDDELNDLYITEKFNSE GDGQPRQGTNHEEIEMLLENYYQTIDEIVQIVENLKNQIKTTEDLINVVLDSNRNQLMLL GLKFSTGLLSMGVALYVSALYGMNLENFIEEIDGGFEVVTVVSTIALIALLLFSVKQLKK VEKVTMTSLNDQRK
Uniprot No.

Target Background

Function
Recombinant *Candida albicans* Mitochondrial inner membrane magnesium transporter LPE10 (LPE10) is a mitochondrial inner membrane magnesium transporter essential for maintaining mitochondrial magnesium homeostasis. It modulates the conductance of the MRS2 channel and participates in the splicing of mitochondrial mRNA group II introns by influencing mitochondrial magnesium concentrations, which are crucial for this splicing process.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does LPE10 relate to other magnesium transporters?

LPE10 shares significant homology with other magnesium transporters in the CorA superfamily:

TransporterLocationOrganismSimilarity to C. albicans LPE10Function
MRS2Mitochondrial inner membraneVarious fungi/yeasts32% identicalMagnesium transport into mitochondrial matrix
LPE10Mitochondrial inner membraneS. cerevisiae~30% identicalMagnesium homeostasis and group II intron splicing
ALR1/ALR2Plasma membraneS. cerevisiaeLower homologyCell-level magnesium uptake
CorACell membraneBacteria (e.g., S. typhimurium)Functional homologyPrimary bacterial Mg²⁺ uptake system

Research indicates that while LPE10 and MRS2 have similar functions, they cannot easily substitute for each other, suggesting specialized roles within the mitochondrial magnesium transport system .

What expression systems are optimal for recombinant LPE10 production?

For optimal recombinant LPE10 production, E. coli has been the predominant expression system used in research settings . The methodology typically involves:

  • Gene synthesis or cloning of the mature protein sequence (amino acids 20-453)

  • Insertion into an expression vector with an N-terminal His-tag

  • Expression in E. coli under optimized conditions

  • Purification using affinity chromatography

Research suggests the following considerations for successful expression:

ParameterRecommended ConditionsNotes
Expression hostE. coli BL21(DE3)Most commonly used strain for recombinant LPE10
InductionIPTG (0.5-1.0 mM)Temperature reduction to 18-25°C upon induction improves solubility
PurificationNi-NTA affinity chromatographyHis-tagged protein allows for efficient single-step purification
StorageTris/PBS-based buffer with 6% trehalose, pH 8.0Addition of 50% glycerol for long-term storage at -20°C/-80°C

For functional studies, reconstitution into liposomes or nanodiscs may be necessary to maintain the native conformation of the transmembrane domains.

How can researchers verify the functional activity of recombinant LPE10?

Verifying functional activity of recombinant LPE10 requires assessment of its magnesium transport capabilities. Recommended methodologies include:

  • Liposome-based transport assays:

    • Reconstitute purified LPE10 into liposomes

    • Load fluorescent magnesium indicators (e.g., Mag-Fura-2)

    • Monitor magnesium influx using fluorescence spectroscopy

  • Complementation assays:

    • Use LPE10-deficient yeast strains (lpe10Δ) displaying growth defects on non-fermentable substrates

    • Transform with recombinant LPE10 and assess rescue of growth phenotype

    • Compare growth rates in media with varying magnesium concentrations

  • Patch-clamp electrophysiology:

    • For direct measurement of channel activity similar to methods used for MRS2

    • Can determine magnesium selectivity and transport kinetics

A successful complementation assay would show restoration of growth on non-fermentable substrates and normalization of mitochondrial magnesium concentrations .

What is the role of LPE10 in C. albicans pathogenicity?

The role of LPE10 in C. albicans pathogenicity is multifaceted, tied to its function in mitochondrial magnesium homeostasis:

  • Mitochondrial function maintenance:

    • Disruption of LPE10 function impairs mitochondrial energy production

    • Affects stress responses and metabolic flexibility required during infection

  • Cell wall integrity and immune recognition:

    • Changes in mitochondrial function can alter cell wall composition

    • Modified cell walls affect host immune recognition, as demonstrated in EDTA treatment studies that alter metal homeostasis

  • Virulence factor expression:

    • Gene expression studies show that altered metal homeostasis (which LPE10 contributes to) can affect virulence gene expression

    • RNA-seq analysis of metal-depleted C. albicans showed differential expression of virulence factors including CHT4 and PGA13

Research using RNA-seq analysis of C. albicans under metal limitation conditions revealed 799 differentially expressed genes, suggesting magnesium transport dysfunction could have widespread effects on virulence pathways .

How does LPE10 function differ between pathogenic and non-pathogenic fungi?

Comparative analysis of LPE10 between pathogenic C. albicans and non-pathogenic fungi reveals important functional differences:

SpeciesLPE10 FeaturesFunctional ImplicationsResearch Evidence
C. albicans (pathogenic)Extended N-terminal domain with additional serine-rich regionsPotential regulatory function specific to pathogenesisSequence analysis shows unique motifs not present in non-pathogenic homologs
K. lactis (non-pathogenic)Shorter protein (349 aa vs 434 aa in C. albicans)Possibly simplified regulation in non-pathogenic contextDifferent amino acid composition in transmembrane domains
A. gossypii (non-pathogenic)Different expression region (14-330)Altered membrane topologySequence comparison shows structural differences in the channel-forming region
S. cerevisiae (non-pathogenic)Higher percentage of hydrophobic residues in transmembrane domainsMay affect magnesium selectivity and transport efficiencyGrowth complementation studies suggest functional differences

These differences may contribute to the pathogenic capabilities of C. albicans by allowing more sophisticated regulation of magnesium homeostasis under stressful host conditions, including immune response and nutrient limitation environments.

How can researchers perform site-directed mutagenesis to study LPE10 functional domains?

Site-directed mutagenesis of LPE10 can provide valuable insights into structure-function relationships. The methodology should include:

  • Target selection based on sequence conservation:

    • The Y/F-G-M-N signature motif at the end of transmembrane domain

    • Conserved residues in transmembrane domains that form the channel pore

    • Potential regulatory sites in the N-terminal domain

  • Mutagenesis protocol:

    • Use overlap extension PCR or commercially available mutagenesis kits

    • Design primers with 15-20 bp flanking sequences around the mutation site

    • Confirm mutations by sequencing before expression

  • Functional analysis of mutants:

    • Compare magnesium transport activity of wild-type and mutant proteins

    • Assess oligomerization capacity (LPE10 likely forms homopentamers like related transporters)

    • Determine subcellular localization using fluorescent tags

Research on related transporters suggests focusing on mutations in the following residues:

DomainTarget ResiduesExpected EffectAnalytical Method
TransmembraneG-M-N motifDisruption of ion selectivityMg²⁺ transport assays
N-terminalSerine-rich regionsAltered regulationPhosphorylation studies
TM1-TM2 linkerCharged residuesChanged gating propertiesElectrophysiology

Similar approaches with MRS2 have successfully identified key functional residues, and these methods could be adapted for LPE10 research .

What techniques are most effective for studying LPE10 oligomerization and channel formation?

Based on structural studies of related transporters, LPE10 likely forms homopentameric channels. The following techniques are recommended for studying oligomerization:

  • Biochemical approaches:

    • Blue Native PAGE for native protein complexes

    • Chemical crosslinking followed by SDS-PAGE

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Biophysical methods:

    • Analytical ultracentrifugation to determine oligomeric state

    • Förster resonance energy transfer (FRET) using differentially labeled LPE10 monomers

    • Single-particle cryo-electron microscopy for structural determination

  • Computational modeling:

    • Homology modeling based on crystal structures of related transporters (e.g., T. maritima CorA)

    • Molecular dynamics simulations to study channel opening and ion permeation

Studies on the related MRS2 channel have successfully employed cryo-electron microscopy to resolve the pentameric structure, revealing that magnesium ions (green) are translocated across the inner mitochondrial membrane through a central pore regulated by specific gates (R332 and M336) .

How might LPE10 serve as a target for novel antifungal therapeutics?

LPE10's essential role in mitochondrial function makes it a promising target for antifungal development:

  • Rationale for targeting LPE10:

    • Disruption of mitochondrial magnesium homeostasis could impair C. albicans virulence

    • The structural differences between fungal and human magnesium transporters may allow selective targeting

    • Metal chelation (e.g., with EDTA) has shown promise in attenuating C. albicans virulence

  • Potential therapeutic approaches:

    • Small molecule inhibitors designed to block the magnesium channel pore

    • Peptides targeting the unique N-terminal domain of fungal LPE10

    • RNA interference or CRISPR-based approaches to downregulate LPE10 expression

Research using EDTA-treated C. albicans demonstrates that disruption of metal homeostasis can attenuate virulence and potentially generate protective immunity in animal models . This suggests that targeted disruption of LPE10 function could produce similar effects.

What are the challenges in studying LPE10 interactions with the mitochondrial proteome?

Investigating LPE10's interactions with other mitochondrial proteins presents several methodological challenges:

ChallengeMethodologyConsiderations
Membrane protein solubilizationMild detergents (DDM, LMNG) or nanodiscsMust maintain native interactions while extracting from membrane
Low abundance of interacting partnersProximity labeling (BioID, APEX)Allows identification of transient interactions in native environment
Distinguishing direct from indirect interactionsCrosslinking mass spectrometry (XL-MS)Can capture direct protein-protein contacts
Functional validation of interactionsCo-immunoprecipitation with mutational analysisRequired to confirm biological relevance

Recent advances in mitochondrial interactome studies suggest combining proximity labeling with quantitative proteomics to identify the protein network around LPE10. Additionally, reconstitution systems using purified components can help validate direct interactions.

What are the optimal storage and handling conditions for recombinant LPE10 protein?

Proper storage and handling are critical for maintaining LPE10 activity:

  • Short-term storage:

    • Store working aliquots at 4°C for up to one week

    • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Long-term storage:

    • Store at -20°C/-80°C with 50% glycerol as cryoprotectant

    • Aliquot to avoid repeated freeze-thaw cycles

    • Lyophilization may be used for extended storage periods

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for stability

For experimental applications, it's essential to verify protein activity after storage using functional assays, as membrane proteins can lose activity even when appearing intact by SDS-PAGE analysis.

How can researchers troubleshoot common issues in LPE10 functional studies?

IssuePotential CausesTroubleshooting Approaches
Low protein expressionToxicity to host cells, improper codon usageUse lower induction temperature, codon-optimized constructs
Protein aggregationImproper folding of transmembrane domainsInclude detergents or lipids during purification, try different solubilization methods
Lack of transport activityDenaturation during purification, incorrect oligomerizationOptimize buffer conditions, include magnesium during purification
Failed complementation assaysImproper localization to mitochondriaVerify mitochondrial targeting using fluorescent tags or fractionation
Inconsistent magnesium measurementsContamination with external magnesiumUse metal-free reagents, include appropriate chelators in controls

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.