Recombinant Candida albicans Mitochondrial inner membrane magnesium transporter mrs2 (MRS2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MRS2; CAALFM_CR01960CA; CaO19.10128; CaO19.2597; Mitochondrial inner membrane magnesium transporter MRS2; RNA-splicing protein MRS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-468
Protein Length
Full Length of Mature Protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
MRS2
Target Protein Sequence
KSNNVGSQDSKRTSKNSILHNLGSYSNSAESEILNKLKPITPNDLYVSCTSFDRIGNITA
VSRKYPKMQFLKENHLFPRDLRKIDTSSIDVVPVIMIRPSSAILVNLLHIKAIIKKDNVM
VFDTSKSEVATKLGIFMYDLELKLKSPANNVCYEFRALESILVSVTSYLEAEIKLHRQQC
GIILAELEDEVDRAKLQELLIRSKKLSSFHQRAILIRDVLEELLENDEDLAGMYLTDLKR
FEPEEENYEEIESILESYYNQCDEYVQQAGSLLSDIKATEEIVNIILDANRNSLMLFELK
ITVYTLGFTVATLVPAFYGMNLKNYIEETNWGFGLVLVVSLLQGLAITWLNFRKLHKVQK
LTMMGTSNSSKAGTGLSRHIPPTSRVDRWKRGSFLYRLFYGSGGKYSKPSKKFDRPTNRE
KDAMWRMINDDKAMK
Uniprot No.
Target Background
Function
Recombinant *Candida albicans* Mitochondrial inner membrane magnesium transporter mrs2 (MRS2) is a high-conductance magnesium-selective channel mediating magnesium influx into the mitochondrial matrix. It plays a crucial role in mitochondrial mRNA group II intron splicing by modulating mitochondrial magnesium concentrations, essential for this process. Furthermore, MRS2 suppresses various mitochondrial intron mutations, and its absence can disrupt the assembly of mitochondrial membrane complexes.
Database Links
KEGG: cal:CAALFM_CR01960CA
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
