Recombinant Candida albicans Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Candida albicans Mitochondrial Intermembrane Space Import and Assembly Protein 40 (MIA40)

Mitochondria, essential organelles in eukaryotic cells, rely on the import of proteins synthesized in the cytosol . This import process is facilitated by a complex machinery, including the translocase of the outer membrane (TOM) complex and the redox-regulated translocator Tim40/Mia40 . MIA40, a highly conserved mitochondrial protein, plays a crucial role in the import and oxidative folding of proteins within the mitochondrial intermembrane space (IMS) . It acts as a receptor, recognizing and binding to cysteine-rich proteins, preventing their retrotranslocation .

Functional Mechanism of MIA40

After proteins cross the outer membrane via the TOM40 complex, they bind to MIA40 . The interactions between the oxidized form of MIA40 and its substrates involve disulfide bonds, leading to the transfer of a disulfide bond from MIA40 to the substrate proteins . The resulting reduced form of MIA40 is then re-oxidized by the sulfhydryl oxidase Erv1 in the IMS . Hot13 promotes the disulfide transfer reaction mediated by MIA40 and interacts with MIA40, preventing it from binding to Zn2+ and facilitating its efficient oxidation by Erv1 . Studies indicate that the ability of MIA40 to bind proteins, rather than its enzymatic activity, drives protein import into the IMS .

MIA40 and Apoptosis-Inducing Factor 1 (AIFM1)

MIA40 interacts with apoptosis-inducing factor 1 (AIFM1) and suppresses AIFM1-induced cell death in a NADH-dependent manner . The N-terminal domain of MIA40 interacts with the AIFM1 dimer, forming an extended β-sheet with AIFM1's C-terminal domain . Complex I impairment and an increased NADH/NAD+ balance could enhance AIFM1-MIA40 interaction, potentially improving MIA40 pathway efficiency to recover complex I biogenesis .

MIA40 in Candida albicans

Recombinant Candida albicans MIA40 is produced in yeast, E. coli, Baculovirus, and mammalian cells .

Table: Properties of Recombinant Candida albicans MIA40

PropertyDescription
SourceYeast, E. coli, Baculovirus, Mammalian cell
RoleEssential for the import and oxidative folding of proteins in the mitochondrial intermembrane space
StructureContains six conserved cysteine residues forming a CPC motif and twin CX9C motifs
FunctionActs as a receptor for cysteine-rich proteins, transferring disulfide bonds
InteractionsInteracts with Erv1 for re-oxidation and AIFM1 to suppress cell death
Additional roleMay function as an Fe-S protein with an undefined role

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MIA40; TIM40; CAALFM_C102880CA; Ca49C10.16; CaO19.10494; CaO19.2977; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-252
Protein Length
Full Length of Mature Protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
MIA40
Target Protein Sequence
SQYNSKLLLGVLGTGALAFGYFSQQSSLIQNASTAENIEKVFEEGNAVAKDAQESLDARQ EKVIKENEQKTKKAEDAKTSSESKANVADKKSNSQPEGEPEGEGKQEAAFNPDTGEINWD CPCLGGMAHGPCGEEFKEAFSCFVFSETEPKGIDCIKKFENMRSCFKRYPEHYKDELYDD GEEEASTEVVEHVVLETSEPAIEQIEQGIKEDKVKPNTKSD
Uniprot No.

Target Background

Function

Required for the import and folding of small cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). MIA40 functions in a redox cycle with ERV1, utilizing a disulfide relay system. Precursor proteins destined for the IMS are translocated in their reduced state into the mitochondria. Oxidized MIA40 forms a transient intermolecular disulfide bond with the reduced precursor protein, resulting in precursor protein oxidation. This oxidized precursor, now containing an intramolecular disulfide bond, can then undergo proper folding within the IMS.

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What is the basic structure and functional domains of C. albicans MIA40?

C. albicans MIA40, like other fungal Mia40 proteins, consists of two main functional elements: an N-terminal redox-active cysteine-proline-cysteine (CPC) motif and a C-terminal hydrophobic substrate-binding pocket. The CPC motif is critical for the oxidation of substrate proteins, while the hydrophobic pocket facilitates substrate binding . In fungi, Mia40 is typically synthesized as a larger protein with an N-terminal presequence, in contrast to metazoan and plant counterparts that consist mainly of the conserved C-terminal domain . The substrate-binding region contains conserved phenylalanine residues (corresponding to positions 315 and 318 in yeast Mia40) that are essential for substrate interaction .

How does C. albicans MIA40 facilitate protein import into the mitochondrial intermembrane space?

C. albicans MIA40 functions as a trans-site receptor that drives protein import through hydrophobic substrate binding. When precursor proteins enter the intermembrane space (IMS), Mia40 recognizes internal signals called MISS or ITS sequences and binds them through its hydrophobic pocket . This binding step is both necessary and sufficient to promote protein import, indicating that substrate trapping by Mia40 is the primary driver of protein translocation across the outer membrane . Following binding, the CPC motif of Mia40 catalyzes disulfide bond formation in substrate proteins, stabilizing their folded structure and preventing their retrotranslocation to the cytosol .

What is the oxidation mechanism of C. albicans MIA40 during substrate protein import?

During substrate oxidation, the redox-active CPC motif of C. albicans MIA40 forms a mixed disulfide intermediate with incoming substrate proteins. This transient disulfide bond is subsequently resolved, resulting in the oxidation of substrate cysteines and the reduction of Mia40 . To restore its oxidized state, Mia40 interacts with Erv1 (Essential for respiration and viability 1), a sulfhydryl oxidase that reoxidizes Mia40 . This creates an electron transfer chain where electrons flow from the substrate protein to Mia40, then to Erv1, and ultimately to molecular oxygen via cytochrome c and the respiratory chain .

What expression systems are most effective for producing recombinant C. albicans MIA40?

Based on experimental approaches with yeast Mia40, bacterial expression systems utilizing E. coli are effective for producing recombinant Mia40 proteins. For functional studies, researchers have successfully expressed the C-terminal domain (Mia40 core) with an N-terminal His-tag for purification purposes . When designing expression constructs for C. albicans MIA40, consider including only the conserved functional C-terminal domain (amino acids corresponding to residues 226-403 in S. cerevisiae Mia40) . To enhance solubility and facilitate purification, incorporate an N-terminal affinity tag such as a His-tag, which can be used for downstream applications including affinity chromatography and in vitro interaction studies .

What purification strategy yields the highest activity for recombinant C. albicans MIA40?

A multi-step purification approach is recommended:

  • Initial capture using Ni-NTA affinity chromatography based on the His-tag

  • Buffer exchange to remove imidazole using either dialysis or gel filtration

  • Quality assessment using SDS-PAGE under both reducing and non-reducing conditions to verify the correct disulfide bond formation

Critical considerations include:

  • Maintaining reducing agents at appropriate concentrations to preserve the redox-active CPC motif

  • Avoiding irreversible oxidation of cysteines by performing purification steps under controlled atmospheric conditions

  • Verifying functional activity through substrate binding assays using model substrates such as Tim9

How can researchers assess the substrate binding activity of recombinant C. albicans MIA40?

The substrate binding activity of recombinant C. albicans MIA40 can be assessed using the following methodological approach:

  • Incubate purified recombinant MIA40 with 35S-labeled precursor proteins (e.g., Tim9)

  • Analyze the formation of MIA40-substrate conjugates using non-reducing SDS-PAGE

  • Detect the conjugates through autoradiography or western blotting

This approach has been successfully employed with recombinant yeast Mia40 core protein, which efficiently formed conjugates with Tim9 precursor proteins . The stability of these disulfide-linked MIA40-precursor conjugates under non-reducing conditions makes this a reliable assay for substrate binding activity . Quantitative analysis can be performed by comparing band intensities between wild-type and mutant versions of MIA40 or between different experimental conditions.

What methods can distinguish between the oxidase and chaperone functions of C. albicans MIA40?

To distinguish between the oxidase and chaperone functions of C. albicans MIA40, researchers can employ the following strategies:

  • Mutational analysis approach:

    • Generate MIA40 variants with mutations in the CPC motif (e.g., SPS mutation) to specifically disrupt oxidase function

    • Create variants with mutations in the hydrophobic binding pocket (e.g., replacing conserved phenylalanine residues with glutamate) to disrupt substrate binding

    • Compare these variants in functional assays to isolate each activity

  • Chemical complementation approach:

    • Use chemical oxidants like diamide to bypass the oxidase function of MIA40

    • Assess whether substrate binding alone (in oxidase-deficient mutants) is sufficient for protein import in the presence of these chemical oxidants

  • In vitro reconstitution:

    • Analyze substrate folding in the presence of oxidized glutathione (oxidative folding) versus in the presence of MIA40 to distinguish between non-specific oxidation and chaperone-assisted folding

Research has shown that the substrate-binding function of MIA40 is both necessary and sufficient to promote protein import, while the oxidase function can be partially complemented by chemical oxidants under certain conditions .

How does C. albicans MIA40 structurally and functionally differ from S. cerevisiae MIA40?

While specific comparative data on C. albicans MIA40 is limited in the provided search results, we can draw inferences based on the general conservation of Mia40 among fungi. Both C. albicans and S. cerevisiae are fungi and likely share similar Mia40 features, including:

  • Structural similarities:

    • Both likely contain an N-terminal presequence directing the protein to mitochondria

    • Both share the conserved C-terminal domain with the redox-active CPC motif and hydrophobic binding pocket

  • Functional conservation:

    • The core import mechanism involving substrate binding and oxidation is likely conserved

    • Both interact with Erv1 to maintain the redox relay system

Any species-specific differences would likely be found in:

  • The length and composition of the N-terminal region

  • Substrate specificity due to variations in the hydrophobic binding pocket

  • Potential adaptations related to C. albicans pathogenicity or its dimorphic growth patterns

Can human MIA40 complement C. albicans MIA40 function in experimental systems?

Based on research with S. cerevisiae, human MIA40 can likely complement C. albicans MIA40 function in experimental systems. Studies have shown that human MIA40, which consists primarily of the conserved C-terminal domain without an N-terminal presequence, can rescue the viability of Mia40-deficient yeast . This functional complementation occurs despite structural differences, as human MIA40 lacks the N-terminal presequence typical of fungal Mia40 proteins .

For experimental design, researchers can:

  • Generate C. albicans strains with conditional expression of endogenous MIA40

  • Introduce human MIA40 via plasmid-based expression

  • Assess functional complementation through:

    • Growth phenotypes under conditions that require mitochondrial function

    • Import efficiency of known MIA40 substrates

    • Formation of proper disulfide bonds in substrate proteins

How can C. albicans MIA40 be targeted for antifungal development?

C. albicans MIA40 represents a potential target for antifungal development due to several key factors:

  • Essential function: MIA40 is essential for viability in fungi, as demonstrated in S. cerevisiae studies

  • Structural differences from human ortholog:

    • Fungal MIA40 contains an N-terminal presequence absent in the human protein

    • These structural differences could be exploited for selective targeting

  • Central role in mitochondrial function:

    • Inhibition of MIA40 would disrupt multiple aspects of mitochondrial biogenesis

    • This would affect energy production critical for fungal pathogenicity

Research approaches may include:

  • High-throughput screening for small molecules that specifically disrupt C. albicans MIA40-substrate interactions

  • Structure-based drug design targeting the CPC motif or hydrophobic binding pocket

  • Peptide inhibitors mimicking substrate binding regions that competitively inhibit natural substrate import

What role does C. albicans MIA40 play in oxidative stress response and virulence?

While direct evidence for C. albicans MIA40's role in oxidative stress response is not provided in the search results, we can infer its importance based on its function and substrates:

Research methodologies to explore this connection could include:

  • Generate conditional MIA40 mutants and assess their sensitivity to oxidative stressors

  • Evaluate virulence of MIA40-depleted strains in animal infection models

  • Analyze the mitochondrial proteome under MIA40 depletion to identify key virulence-associated substrates

How can researchers overcome aggregation issues when working with recombinant C. albicans MIA40?

Recombinant MIA40 may be prone to aggregation due to its cysteine-rich nature and hydrophobic binding surfaces. To address this challenge:

  • Optimization of expression conditions:

    • Lower expression temperature (16-20°C) to slow protein synthesis and facilitate proper folding

    • Use specialized E. coli strains with enhanced disulfide bond formation capabilities (e.g., Origami, SHuffle)

    • Co-express thioredoxin or other folding chaperones

  • Buffer optimization:

    • Include stabilizing agents such as glycerol (10-15%) or low concentrations of non-ionic detergents

    • Maintain reducing agents at optimal concentrations to prevent non-specific disulfide bond formation

    • Consider using arginine (50-100 mM) to reduce protein-protein interactions

  • Purification strategies:

    • Implement on-column refolding protocols during affinity purification

    • Utilize size exclusion chromatography to separate monomeric protein from aggregates

    • Consider fusion tags that enhance solubility (e.g., MBP, SUMO)

What are the critical controls needed when studying C. albicans MIA40-substrate interactions?

When studying C. albicans MIA40-substrate interactions, several critical controls should be included:

  • Redox state controls:

    • DTT-treated samples to demonstrate disulfide dependence of interactions

    • Iodoacetamide-treated samples to block free thiols and prevent disulfide exchange

    • Non-reducing vs. reducing SDS-PAGE to verify disulfide-dependent interactions

  • Substrate specificity controls:

    • Non-MIA40 pathway proteins to demonstrate specificity

    • Mutated substrates lacking critical cysteine residues

    • Competition experiments with known substrates

  • Functional mutant controls:

    • MIA40 CPC→SPS mutants to disrupt oxidase function

    • MIA40 with mutated hydrophobic pocket to disrupt substrate binding

    • These mutants help distinguish between oxidation and binding functions

  • Import pathway controls:

    • Membrane potential dissipation (e.g., CCCP treatment) to confirm import mechanism

    • Erv1 depletion or inhibition to verify the complete electron transfer chain

    • Temperature-sensitive mutants of import machinery components

How might advanced structural studies enhance our understanding of C. albicans MIA40?

Advanced structural studies of C. albicans MIA40 would significantly advance our understanding in several key areas:

  • High-resolution structures through cryo-EM or X-ray crystallography:

    • Reveal species-specific features of the substrate binding pocket

    • Identify potential allosteric sites for selective inhibitor design

    • Characterize the conformational changes during substrate binding and release

  • Dynamic studies using nuclear magnetic resonance (NMR):

    • Map the conformational dynamics during substrate recognition

    • Identify transient binding interfaces with various substrates

    • Characterize the redox-dependent structural changes

  • Structural analysis of MIA40-substrate complexes:

    • Determine how different substrates dock onto the hydrophobic binding pocket

    • Elucidate the molecular details of the disulfide exchange reaction

    • Identify species-specific substrate recognition features

These structural insights would facilitate rational drug design targeting C. albicans MIA40 and provide a deeper understanding of its functional mechanisms in pathogenesis.

What emerging technologies could enhance the study of C. albicans MIA40 in physiological contexts?

Several emerging technologies offer promising avenues for studying C. albicans MIA40 in more physiological contexts:

  • Proximity labeling techniques:

    • BioID or APEX2 fusions to MIA40 to identify transient interacting partners in vivo

    • Temporal mapping of the MIA40 interactome during different growth phases and stress conditions

    • Identification of novel substrates specific to C. albicans

  • Live-cell imaging approaches:

    • Split fluorescent protein systems to visualize MIA40-substrate interactions in real-time

    • FRET-based redox sensors to monitor MIA40 oxidation state fluctuations

    • Super-resolution microscopy to visualize MIA40 distribution within mitochondria

  • Single-cell proteomics:

    • Analysis of MIA40-dependent protein import in individual C. albicans cells

    • Correlation of import efficiency with cellular phenotypes and virulence traits

    • Mapping heterogeneity in mitochondrial function within populations

  • Genetic screening using CRISPR interference:

    • Identification of genetic modifiers of MIA40 function

    • Discovery of compensatory pathways activated upon MIA40 depletion

    • Targeted screening for synthetic lethal interactions to identify potential combination therapies

These approaches would provide unprecedented insights into the dynamics and regulation of MIA40 function in the context of C. albicans physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.