Recombinant Candida albicans NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Description

Functional Roles

MCR1 participates in:

  • Ergosterol biosynthesis: Electron transfer to cytochrome b5 for sterol desaturation .

  • Oxidative stress response: Overexpression enhances resistance to hydrolysate inhibitors (e.g., furfural) by accelerating furaldehyde reduction .

  • Fatty acid metabolism: Supports PUFA biosynthesis in M. alpina via NADH-dependent electron transport .

Recombinant Expression and Purification

  • Expression systems: Successfully expressed in E. coli (limited solubility) and Pichia pastoris .

  • Purification methods:

    • Solubilization with cholic acid followed by DEAE-Sephacel and AMP-Sepharose chromatography .

    • His-tagged variants achieve >90% purity via immobilized metal affinity chromatography .

Table 2: Enzymatic Activity of Recombinant MCR1 Homologs

SourceSpecific Activity (NADH-ferricyanide reductase)Substrate PreferenceThermal Stability
M. alpina CbR645-fold purified activityNADH > NADPHNot reported
S. cerevisiae MCR1Not quantifiedNADHATP-dependent

Research Implications

  • Biotechnological applications: Engineered S. cerevisiae strains with MCR1 overexpression show improved ethanol production rates in lignocellulose hydrolysates .

  • Mitochondrial dynamics: Incomplete outer membrane arrest sorts MCR1 to dual submitochondrial compartments, suggesting regulatory crosstalk between translocation machineries .

Knowledge Gaps

No direct studies on Candida albicans MCR1 exist in the reviewed literature. Current insights derive from homologous systems, highlighting the need for C. albicans-specific investigations to resolve its role in pathogenicity or antifungal resistance.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MCR1; CAALFM_C602040WA; CaO19.11001; CaO19.3507; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
MCR1
Target Protein Sequence
MLTHHLSKLATPKFLVPFAGATALSIGLALQYSTSNNYIANETGKTFTDSNEWVDLKLSK SIDLTHNTKHLVFKLKDENDVSGLITASCLLTKFVTPKGNNVIRPYTPVSDVNQSGEIDF VIKKYDGGKMSSHIFDLKEGETLSFKGPIVKWKWEPNQFKSIALIGGGTGITPLYQLLHQ ITSNPKDNTKVNLIYGNLTPEDILLKKEIDAIASKHKDQVKVHYFVDKADEKKWEGQIGF ITKEFLQKELEKPGSDFKVFVCGPPGLYKAISGPKVSPTDQGELTGALKDLGFEKEHVFK F
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.