Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 3 (NAD3)

What is the basic structure and function of Candida albicans NADH-ubiquinone oxidoreductase chain 3?

NADH-ubiquinone oxidoreductase chain 3 (NAD3) is a mitochondrial protein that functions as part of the electron transport chain in Candida albicans. The full-length protein consists of 129 amino acids with the sequence: MFTFYMYLAPIVAGVLIGLNWLLAKSNPNIDKAGPFECGFTSYQQSRAAFSVAFILVAILFLPFDLEISSILPYVTSAYNNGLYGLIILIIFLMMLVIAFILEIQLRVLKIERSYDKDRSDSNYYDHEI . As a component of Complex I in the respiratory chain, NAD3 plays a crucial role in energy metabolism and potentially in the virulence of this pathogenic fungus. The protein contains hydrophobic regions consistent with its membrane-embedded nature in the mitochondrial inner membrane.

How is recombinant NAD3 typically produced for research applications?

Recombinant full-length Candida albicans NAD3 protein is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. The protein (corresponding to UniProt ID Q9B8D1) spans the complete 1-129 amino acid sequence of the native protein . After expression, the protein is purified using affinity chromatography leveraging the His tag, and typically delivered as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis. This production method enables researchers to obtain sufficient quantities of the protein for structural studies, enzymatic assays, and antibody generation.

What are the optimal storage conditions for maintaining NAD3 protein stability?

For optimal stability, recombinant NAD3 protein should be stored at -20°C to -80°C upon receipt, with aliquoting being necessary for multiple use scenarios to avoid repeated freeze-thaw cycles . The lyophilized protein is typically stored in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being standard) is recommended for long-term storage at -20°C/-80°C . Working aliquots may be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to preserve protein integrity.

What experimental techniques are most effective for studying NAD3 function in Candida albicans?

Several complementary methodologies are recommended for investigating NAD3 function:

• Genetic manipulation: CRISPR-Cas9 or homologous recombination approaches to create NAD3 deletion or point mutants in C. albicans.

• Respirometry assays: Measuring oxygen consumption rates in wild-type versus NAD3-mutant strains to assess respiratory chain function.

• Mitochondrial isolation: Subcellular fractionation to isolate intact mitochondria for functional studies.

• Blue Native PAGE: For analyzing intact respiratory complexes and NAD3 incorporation into Complex I.

• Immunochemical approaches: Using antibodies against the recombinant NAD3 to detect native protein in cellular fractions.

• Protein-protein interaction studies: Co-immunoprecipitation or yeast two-hybrid analyses to identify interacting partners.

When designing these experiments, researchers should consider the potential impact of the His tag on protein function and include appropriate controls to account for any artifacts introduced by the tag.

How can researchers effectively use NAD3 in studies of antifungal resistance mechanisms?

Researchers can utilize recombinant NAD3 and NAD3 mutants to investigate potential connections between mitochondrial function and antifungal resistance in C. albicans through the following approaches:

• Comparative expression analysis: Quantifying NAD3 expression levels in drug-sensitive versus resistant C. albicans isolates.

• Respiration inhibition assays: Evaluating the effects of antifungal agents on NAD3-dependent respiration.

• Biofilm formation studies: Investigating NAD3's potential role in biofilm development, which is often associated with antifungal resistance. This is particularly relevant given that biofilm formation is a major contributor to resistance in C. albicans .

• Combination treatment testing: Assessing synergistic effects between respiratory chain inhibitors and conventional antifungals like fluconazole.

• Cell wall integrity analysis: Examining connections between mitochondrial function and cell wall composition, as cell wall alterations frequently contribute to antifungal resistance.

Based on research with related compounds, it's valuable to examine how NAD3 might influence cell wall organization, as cell wall components like β-glucans, mannan, and chitin are critical determinants of antifungal susceptibility .

What are the recommended protocols for reconstituting and handling recombinant NAD3 for enzymatic assays?

For optimal enzymatic activity in experimental settings:

• Reconstitution procedure:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Mix gently to ensure complete solubilization

  • Add glycerol to a final concentration of 5-50% for storage

• Buffer considerations:

  • For activity assays, a buffer system containing 50 mM potassium phosphate (pH 7.4), 2 mM EDTA, and appropriate substrates is recommended

  • Include protease inhibitors to prevent degradation

• Activity measurement:

  • Monitor NADH oxidation spectrophotometrically at 340 nm

  • Include appropriate electron acceptors (ubiquinone or analogues)

  • Maintain temperature at 30°C (the optimal growth temperature for C. albicans)

• Controls:

  • Include heat-inactivated protein as a negative control

  • Use established Complex I inhibitors (rotenone) to confirm specificity

How can researchers investigate the role of NAD3 in Candida albicans mitochondrial function and virulence?

To investigate the connection between NAD3, mitochondrial function, and virulence in C. albicans:

• Generate conditional mutants: Create strains with inducible NAD3 expression to circumvent potential lethality of complete deletion.

• Mitochondrial membrane potential assays: Use fluorescent dyes like JC-1 or TMRM to assess whether NAD3 mutations affect mitochondrial energetics.

• ROS measurement: Quantify reactive oxygen species production in NAD3 mutants versus wild-type strains, as mitochondrial dysfunction often leads to increased oxidative stress.

• Virulence models: Employ both in vitro (macrophage infection) and in vivo (murine disseminated candidiasis) models to assess virulence alterations in NAD3 mutants, similar to approaches used in studying antifungal compounds .

• Metabolic profiling: Perform metabolomics analysis to identify metabolic pathways affected by NAD3 dysfunction.

• Stress response assays: Test susceptibility to various stressors (oxidative, osmotic, cell wall) in NAD3 mutants, as mitochondrial function is often linked to stress adaptation.

• Morphogenesis studies: Investigate whether NAD3 mutations affect the yeast-to-hyphal transition, a key virulence determinant in C. albicans.

The research findings should be correlated with pathogenicity outcomes to establish causative relationships between NAD3 function and virulence attributes.

What approaches can be used to investigate potential interactions between NAD3 and other mitochondrial proteins in Candida albicans?

Several sophisticated techniques can reveal NAD3's interaction network:

• Proximity-based labeling: BioID or APEX2 tagging of NAD3 to identify proteins in its immediate vicinity within the mitochondrial membrane.

• Crosslinking mass spectrometry (XL-MS): Covalently crosslinking NAD3 to its binding partners followed by mass spectrometry identification.

• Co-immunoprecipitation with tagged NAD3: Pull-down experiments using the His-tagged recombinant protein followed by mass spectrometry.

• Genetic interaction mapping: Systematic creation of double mutants to identify synthetic lethal or synthetic sick interactions.

• Cryo-electron microscopy: Structural studies of purified respiratory complexes containing NAD3.

• Computational prediction: Leveraging existing structural data from other species to model potential interaction interfaces.

• Blue Native PAGE coupled with second-dimension SDS-PAGE: For analyzing complex assembly and composition.

When analyzing potential protein interactions, researchers should consider the possibility that the His tag might interfere with certain protein-protein interactions and design controls accordingly.

How might NAD3 contribute to antifungal resistance mechanisms, and what experimental approaches can test these hypotheses?

NAD3's potential contributions to antifungal resistance can be investigated through these approaches:

• Correlation studies: Compare NAD3 expression levels in clinical isolates with varying antifungal susceptibility profiles.

• Metabolic flexibility assessment: Determine whether NAD3 function affects the ability of C. albicans to utilize alternative carbon sources during antifungal stress.

• Mitochondrial membrane potential measurement: Assess whether changes in NAD3 function alter membrane potential, which could affect drug accumulation.

• Drug efflux activity: Investigate connections between mitochondrial function and drug efflux pump activity.

• Cell wall analysis: Examine whether NAD3 mutations affect cell wall composition, particularly β-glucan exposure and mannan content, which are known to change in response to some antifungal compounds .

Research has shown that compounds affecting fungal metabolism can alter cell wall organization, with impacts on β-glucan exposure, mannan levels, and chitin content . Investigating whether NAD3 dysfunction produces similar alterations could provide insights into its potential role in antifungal resistance mechanisms.

What are common challenges when working with recombinant NAD3 and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant NAD3:

• Protein aggregation: Being a hydrophobic membrane protein, NAD3 can aggregate during purification or storage.

  • Solution: Include mild detergents (0.01-0.05% n-dodecyl β-D-maltoside) in buffers and store at appropriate protein concentrations.

• Loss of activity after reconstitution: Enzymatic activity may decrease rapidly after reconstitution.

  • Solution: Prepare fresh solutions for critical experiments and maintain consistency in reconstitution protocols.

• Interference from the His tag: The N-terminal His tag may affect protein folding or function.

  • Solution: Consider using enzymatic cleavage to remove the tag for functional studies or compare with alternatively tagged versions.

• Purity concerns: Contaminants may affect experimental outcomes.

  • Solution: Employ additional purification steps if the standard >90% purity is insufficient for specific applications.

• Reproducibility issues: Batch-to-batch variations can affect experimental outcomes.

  • Solution: Use consistent sources of recombinant protein and include appropriate internal controls.

• Antibody cross-reactivity: Antibodies against NAD3 may cross-react with other mitochondrial proteins.

  • Solution: Validate antibody specificity using appropriate controls, including NAD3 deletion strains.

How can researchers distinguish between direct and indirect effects when studying NAD3 function in Candida albicans?

To differentiate direct from indirect effects of NAD3 manipulation:

• Complementation studies: Reintroduce wild-type or mutant NAD3 into deletion strains to confirm phenotype rescue.

• Domain-specific mutations: Create point mutations in functional domains rather than complete deletions to minimize compensatory responses.

• Temporal control systems: Use inducible expression systems to observe immediate versus long-term effects of NAD3 depletion.

• Biochemical validation: Purify mitochondrial complexes to directly assess NAD3's biochemical role outside the cellular context.

• Cross-species complementation: Test whether NAD3 orthologs from other species can rescue C. albicans NAD3 mutant phenotypes.

• Epistasis analysis: Determine genetic relationships by creating double mutants of NAD3 with genes in potentially related pathways.

• Targeted metabolomics: Focus on specific metabolic pathways predicted to be directly affected by NAD3 dysfunction.

These approaches collectively provide multiple lines of evidence that can help distinguish direct NAD3 functions from secondary cellular adaptations to its dysfunction.

What controls should be included when evaluating the effects of NAD3 manipulation on Candida albicans phenotypes?

Robust experimental design for NAD3 studies should include these essential controls:

• Parental wild-type strain: Include the direct parent of any mutant strain to account for strain background effects.

• Empty vector controls: For complementation or overexpression studies, include strains carrying the empty expression vector.

• Tagged protein controls: When using tagged versions of NAD3, include controls to assess tag effects on protein function.

• Metabolic controls: Include strains with mutations in other mitochondrial genes to distinguish NAD3-specific effects from general respiratory deficiency.

• Growth condition controls: Test phenotypes under multiple growth conditions, as respiratory requirements vary with carbon source and oxygen availability.

• Cell wall integrity pathway mutants: Include mutants lacking GIN4 or other cell wall integrity proteins as comparators when studying cell wall-related phenotypes .

• Drug treatment controls: When testing antifungal susceptibility, include known resistant and susceptible strains as benchmarks.

• Stress response controls: Include strains with defects in major stress response pathways to differentiate specific from general stress effects.

These controls ensure that observed phenotypes can be confidently attributed to NAD3 function rather than experimental artifacts or generic cellular responses.

What emerging technologies could advance our understanding of NAD3 function in Candida albicans pathogenesis?

Several cutting-edge approaches hold promise for deepening our understanding of NAD3 biology:

• Single-cell techniques: Single-cell RNA-seq and proteomics to assess cell-to-cell variability in NAD3 expression and function during infection.

• In situ structural biology: Cryo-electron tomography of intact C. albicans mitochondria to visualize NAD3 in its native context.

• Real-time imaging: Development of fluorescent sensors to monitor Complex I activity in living C. albicans cells.

• CRISPR interference (CRISPRi): Titratable repression of NAD3 expression to study partial loss-of-function phenotypes.

• Synthetic biology approaches: Reconstitution of minimal respiratory chains with defined components to isolate NAD3-specific functions.

• Organoid infection models: Using human tissue organoids to study NAD3's role during host-pathogen interactions in more physiologically relevant systems.

• Interspecies comparative approaches: Systematic comparison of NAD3 function across Candida species with varying virulence profiles.

• Integration with cell wall studies: Given the connections between metabolic function and cell wall organization , new approaches to study this interface could yield important insights.

These emerging technologies could help resolve outstanding questions about NAD3's precise role in C. albicans biology and pathogenicity.

How might targeting NAD3 or related mitochondrial functions contribute to novel antifungal strategies?

NAD3 and mitochondrial function represent potentially valuable antifungal targets:

• Combination therapies: Respiratory chain inhibitors could be used synergistically with established antifungals like fluconazole, similar to the enhanced activity seen with nicotinamide .

• Biofilm prevention: If NAD3 function influences biofilm formation, inhibitors might prevent the development of these resistant structures.

• Metabolic vulnerabilities: Identifying C. albicans-specific aspects of NAD3 function could reveal selective targets that spare host mitochondria.

• Virulence attenuation: Rather than killing C. albicans directly, NAD3 inhibition might reduce virulence, allowing host immunity to clear the infection.

• Resistance prevention: Targeting conserved mitochondrial functions might reduce the emergence of resistance compared to conventional antifungals.

• Cell wall destabilization: If NAD3 dysfunction affects cell wall organization, inhibitors might sensitize C. albicans to host immune defenses or existing cell wall-targeting drugs.

Research has shown that compounds affecting fungal metabolism (such as nicotinamide) can exhibit significant antifungal activity against C. albicans, including fluconazole-resistant isolates, and can effectively suppress biofilm formation . This suggests that targeting mitochondrial functions could be a promising strategy.

What are the most significant unanswered questions regarding NAD3 biology in Candida albicans?

Critical knowledge gaps in NAD3 biology include:

• Evolutionary adaptation: How has NAD3 function adapted to C. albicans' commensalism and opportunistic pathogenicity compared to non-pathogenic fungi?

• Host interaction: Does NAD3 function change during host colonization or invasion, and do these changes contribute to virulence?

• Biofilm contribution: What specific role, if any, does NAD3 play in biofilm formation and the associated drug resistance?

• Stress response integration: How is NAD3 function integrated with canonical stress response pathways during infection?

• Metabolic flexibility: Does NAD3 contribute to C. albicans' remarkable metabolic adaptability in diverse host niches?

• Regulatory networks: What transcriptional and post-translational mechanisms regulate NAD3 expression and function?

• Cell wall connections: What is the mechanistic link between mitochondrial function and cell wall organization, particularly regarding β-glucan exposure and mannan content ?

• Drug resistance: Does altered NAD3 function contribute to the development of resistance to azole antifungals or other drug classes?

Addressing these questions will require integrative approaches combining genetic, biochemical, and computational methods to fully elucidate NAD3's role in C. albicans biology and pathogenesis.