Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 6 (NAD6)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • Protein Length: Partial sequence (exact residues unspecified) .

  • Molecular Weight: Predicted based on mitochondrial DNA-encoded subunits (~20–25 kDa).

  • Post-Translational Modifications: None reported, but mitochondrial targeting signals are likely present.

  • Expression Systems:

    • Baculovirus: Produces soluble protein with >85% purity via SDS-PAGE .

    • E. coli: Utilized for full-length constructs with His-tags .

Functional Role in Mitochondrial Complex I

NAD6 is integral to the structural and functional integrity of Complex I:

  • Electron Transfer: Participates in NADH oxidation, transferring electrons to ubiquinone (CoQ10) via flavin mononucleotide (FMN) and iron-sulfur clusters .

  • Proton Pumping: Contributes to the generation of the proton gradient across the mitochondrial inner membrane .

  • Pathway Cross-Talk: Indirectly modulates cAMP/PKA signaling by influencing NADH/NAD+ redox balance .

Critical Findings:

  • Complex I Assembly: Deletion of NDU1, a regulatory protein for Complex I, reduces NADH dehydrogenase activity by ~30%, highlighting NAD6’s dependency on proper Complex I assembly .

  • Respiration Defects: C. albicans mutants lacking functional Complex I subunits (e.g., NAD6) fail to grow on non-fermentable carbon sources like glycerol, underscoring their role in oxidative metabolism .

Research Applications and Inhibitor Studies

Recombinant NAD6 is used to study antifungal targets and mitochondrial dysfunction:

Table 2: Key Research Insights

Study FocusFindingsSource
Antifungal TargetingAMPs (e.g., P-113) inhibit C. albicans Complex I, reducing NADH oxidation rates .
Biofilm RegulationNDU1-deficient strains show impaired biofilm dispersal and virulence due to disrupted Complex I activity .
Electron TransferUbiquinone binding sites in homologous enzymes (e.g., Ndi1) involve conserved glycine-rich regions .

Implications for Antifungal Development

NAD6 and Complex I are promising targets due to:

  • Fungal-Specific Features: Unique structural motifs absent in humans .

  • Role in Virulence: Complex I mutants exhibit reduced biofilm formation and pathogenicity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
NAD6; CM_00050W; CaalfMp02; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
NAD6
Target Protein Sequence
MSLISGIASILAIGLLSPVQSILALILLFVTVAINLYTSGYVLMGILYILVYVGAIAILF LFILSLLNIEYKPTGGMHPLVIVLILIPLIPLDIAFEPIAIVESVSTTYNELSIVGTLFY SEYAPMLVIIGIILIVSVIGAIAMTR
Uniprot No.

Target Background

Function
Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 6 (NAD6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly necessary for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. Ubiquinone is thought to be the immediate electron acceptor for the enzyme.
Database Links
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 6 (NAD6) in Candida albicans?

NAD6 (NADH-ubiquinone oxidoreductase chain 6) is a mitochondrial protein in Candida albicans that functions as a core component of the respiratory Complex I (CI). It is encoded by the mitochondrial gene CaalfMp02 and plays a critical role in the NADH oxidation process within the mitochondrial electron transport chain . The protein consists of 146 amino acids and is part of the proton-pumping NADH:ubiquinone oxidoreductase system that contributes to ATP production through oxidative phosphorylation . Unlike Saccharomyces cerevisiae, which lacks a conventional Complex I, C. albicans maintains this respiratory complex as part of its energy metabolism machinery, making it more similar to mammalian systems in this respect while still having fungal-specific features .

How does NAD6 differ from mammalian Complex I components?

NAD6 represents one of the critical functional differences between fungal and mammalian mitochondrial Complex I. Research has demonstrated that C. albicans possesses unique subunit proteins in its respiratory Complex I that are absent in mammalian systems . Specifically, proteins designated as Nuo1p and Nuo2p (NADH-ubiquinone oxidoreductases) have been identified in fungal mitochondria but not in mammals . Additionally, while both systems contain core components with similar functions, C. albicans has seven mitochondrially-encoded Complex I genes (including CaalfMp02 encoding NAD6) and seven nuclear-encoded subunit genes that together form the functional complex . These fungal-specific differences in Complex I composition and the unique properties of NAD6 make it particularly interesting as a potential target for antifungal drug development, as inhibiting this protein would not affect mammalian cells .

How should researchers reconstitute and store recombinant NAD6 protein for optimal stability?

For optimal stability and experimental reproducibility, recombinant NAD6 protein should be handled according to the following protocol:

  • Centrifuge the lyophilized protein vial briefly before opening to ensure all material is at the bottom of the tube .

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage) to prevent freeze-thaw damage .

  • Aliquot the reconstituted protein into small volumes to avoid repeated freeze-thaw cycles .

  • Store working aliquots at 4°C for up to one week for immediate experimental use .

  • For long-term storage, keep aliquots at -20°C or preferably -80°C .

It is crucial to avoid repeated freeze-thaw cycles as these significantly compromise protein stability and activity. For experiments requiring multiple uses, prepare small working aliquots rather than repeatedly freezing and thawing a single stock . The recommended storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

What methods are effective for detecting NAD6 in experimental systems?

Several complementary approaches can be employed for detecting NAD6 in experimental systems:

  • Western Blotting: For tagged recombinant versions, anti-His antibodies can be used at 1:5000 dilution. For example, anti-TAP-Tag monoclonal antibodies have been shown to produce clean detection of similarly sized mitochondrial proteins in the 38-52 kDa range . Optimize primary antibody concentration through titration experiments.

  • Mass Spectrometry: For unambiguous identification, tryptic digestion followed by LC-MS/MS analysis provides peptide fingerprints that can be matched against protein databases. This approach is particularly valuable for confirming protein identity and post-translational modifications.

  • Functional Assays: NADH oxidation activity can be measured spectrophotometrically by monitoring the decrease in absorbance at 340 nm in the presence of appropriate electron acceptors such as ubiquinone analogs.

  • Immunoprecipitation: ChIP techniques have been successfully applied to other mitochondrial proteins in C. albicans, with clear differentiation between immunoprecipitated samples and untreated controls as demonstrated by Principal Component Analysis .

When designing detection experiments, researchers should include appropriate controls to ensure specificity, particularly given the hydrophobic nature of the protein and potential for non-specific interactions.

What expression systems are most suitable for producing functional recombinant NAD6?

  • Prokaryotic Systems (E. coli):

    • Advantages: High yield, cost-effective, well-established protocols

    • Limitations: Lack of post-translational modifications, potential improper folding of membrane proteins

    • Optimization: Use specialized E. coli strains designed for membrane protein expression (C41, C43)

    • Solubilization: Require careful detergent selection for extraction from inclusion bodies

  • Eukaryotic Systems:

    • Yeast systems (Pichia pastoris): Better for maintaining proper folding of fungal proteins

    • Insect cell systems: Provide more complex post-translational modifications

    • Mammalian cell systems: Highest fidelity but lower yield and higher cost

How can researchers design knockout experiments to study NAD6 function in C. albicans?

Designing effective knockout experiments for NAD6 requires careful consideration of both technical approaches and biological implications:

  • Gene Targeting Strategies:

    • CRISPR-Cas9 systems adapted for C. albicans can be employed with guide RNAs targeting CaalfMp02

    • Homologous recombination approaches using selection markers (URA3, HIS1, or NAT1)

    • Conditional knockout systems for essential genes using tetracycline-regulatable promoters

  • Phenotypic Analysis Protocol:

    • Growth assessment in different carbon sources (dextrose vs. glycerol) to evaluate respiratory capacity

    • Doubling time calculations under various conditions (normoxia vs. hypoxia, different temperatures)

    • Mitochondrial function assays including oxygen consumption rate measurements

    • Morphological assessments for yeast-to-hyphal transition effects

  • Control Considerations:

    • Include parental wild-type strain for direct comparison

    • Use complementation strains where the NAD6 gene is reintroduced to confirm phenotype specificity

    • Compare with other Complex I mutants to establish component-specific effects

As demonstrated in previous Complex I studies, most CI mutants (11/13) failed to grow in glycerol medium, indicating their critical role in respiratory metabolism . When designing NAD6 knockout experiments, researchers should anticipate potential growth defects and prepare appropriate growth media and conditions to accurately characterize the resulting phenotypes. Additionally, measurements of doubling time under different conditions (as seen with other mitochondrial studies showing significant differences between normoxia vs. hypoxia and different carbon sources) will provide valuable insights into the impact of NAD6 on cellular metabolism .

What approaches can be used to study NAD6 interactions with other Complex I components?

Investigating NAD6 interactions with other Complex I components requires multifaceted approaches:

  • Co-immunoprecipitation (Co-IP):

    • Tag NAD6 with epitopes such as His, FLAG, or TAP for pulldown experiments

    • Cross-linking prior to lysis can capture transient interactions

    • Mass spectrometry analysis of co-immunoprecipitated proteins identifies interaction partners

    • Validate interactions with reverse Co-IP using antibodies against potential partners

  • Proximity Labeling Techniques:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to NAD6

    • These techniques are particularly valuable for membrane proteins where traditional Y2H systems fail

    • Expression of NAD6-APEX2 followed by biotin-phenol labeling allows identification of the proximal proteome

  • Structural Analysis:

    • Cryo-EM of purified Complex I can reveal the structural arrangement of NAD6

    • Crosslinking mass spectrometry (CL-MS) can identify amino acids in close proximity

    • Molecular dynamics simulations based on structural data can predict functional interactions

  • Genetic Interaction Mapping:

    • Synthetic genetic arrays comparing growth of single and double mutants

    • CRISPR interference (CRISPRi) targeting multiple Complex I components simultaneously

Research has shown that C. albicans has seven mitochondrially-encoded and seven nuclear-encoded Complex I subunits that work together in the respiratory chain . Understanding NAD6 interactions with these components will provide insights into the assembly, stability, and function of the entire complex. Systematic approaches combining biochemical and genetic methods will reveal the interaction network centered around NAD6 and its role in Complex I architecture.

How does NAD6 contribute to C. albicans virulence and pathogenesis?

The connection between NAD6 function and C. albicans virulence involves several interconnected pathways:

  • Metabolic Flexibility:

    • NAD6 as part of Complex I contributes to respiratory metabolism, enabling adaptation to diverse host environments

    • C. albicans can utilize both fermentative and respiratory pathways, unlike S. cerevisiae which lacks conventional Complex I

    • This metabolic flexibility allows growth in oxygen-limited conditions encountered during infection

  • Morphological Transition:

    • Mitochondrial function impacts hyphal formation, a key virulence trait

    • Complex I activity has been linked to yeast-to-hyphal transition pathways

    • Disruption of mitochondrial genes affects filamentous growth as observed in hfl1Δ/hfl1Δ mutants

  • Stress Resistance:

    • NAD6 function may contribute to resistance against oxidative stress encountered in phagocytes

    • Adaptation to temperature stress (37°C) likely involves mitochondrial respiratory pathways

    • Experimental evolution under hypoxia and heat stress conditions shows differential growth with different carbon sources

  • Interaction with Host Immunity:

    • Mitochondrial proteins may serve as pathogen-associated molecular patterns (PAMPs)

    • Changes in cell wall composition resulting from altered metabolism can affect immune recognition

Research methodologies to investigate these connections include:

  • In vitro virulence assays (biofilm formation, hyphal induction)

  • Cell culture models of host-pathogen interaction

  • Mouse models of systemic and mucosal candidiasis

  • Transcriptomic analysis under infection-relevant conditions

The absence of NAD6 homologs in mammals makes it a particularly interesting target for antifungal development, as inhibiting this protein would potentially disrupt C. albicans metabolism and virulence without directly affecting host mitochondrial function .

What are the challenges in purifying membrane-bound proteins like NAD6 and how can they be overcome?

Purifying membrane-bound proteins like NAD6 presents several technical challenges that can be addressed with specialized approaches:

Challenges and Solutions:

  • Protein Solubilization:

    • Challenge: Hydrophobic nature makes NAD6 difficult to extract from membranes

    • Solution: Systematic screening of detergents (DDM, LMNG, digitonin) at various concentrations

    • Method: Evaluate extraction efficiency using western blotting with anti-His antibodies

    • Alternative: Styrene maleic acid lipid particles (SMALPs) can extract membrane proteins with native lipid environment

  • Maintaining Native Conformation:

    • Challenge: Detergents may disrupt protein structure and function

    • Solution: Use amphipols or nanodiscs for detergent-free stabilization after initial extraction

    • Method: Activity assays comparing different stabilization approaches

    • Consideration: Include lipids from C. albicans mitochondria during reconstitution

  • Aggregation During Concentration:

    • Challenge: Membrane proteins often aggregate during concentration steps

    • Solution: Use spin concentrators with appropriate molecular weight cutoffs and gentle centrifugation

    • Method: Monitor aggregation by dynamic light scattering during concentration

    • Alternative: Concentrate in the presence of glycerol (5-10%) to prevent aggregation

  • Yield Optimization:

    • Challenge: Low expression levels in heterologous systems

    • Solution: Optimize codon usage for expression host and consider fusion partners

    • Method: Compare yields with different tags (His, MBP, SUMO) and expression conditions

    • Alternative: Cell-free expression systems may provide better yields for difficult membrane proteins

When working with recombinant NAD6, researchers should be aware that the His-tagged protein can be successfully purified to >90% homogeneity , but maintaining the protein in a functional state requires careful consideration of buffer composition, detergent choice, and handling procedures. The reconstitution protocol should be followed carefully, with the addition of 5-50% glycerol to stabilize the protein and prevent aggregation during storage .

How can researchers address the challenges of studying mitochondrial DNA-encoded proteins?

Studying mitochondrial DNA-encoded proteins like NAD6 involves unique challenges related to their genetic accessibility and expression:

Methodological Approaches:

  • Genetic Manipulation Strategies:

    • Challenge: Direct editing of mitochondrial DNA is difficult in C. albicans

    • Solution: Mitochondrial transformation using biolistic delivery of DNA

    • Alternative: Expression of mitochondrial genes from nuclear DNA with mitochondrial targeting sequences

    • Consideration: Use of heterologous expression systems for studying protein function

  • Expression Analysis:

    • Challenge: Distinguishing between nuclear and mitochondrial transcription

    • Solution: RNA-seq with specific isolation of mitochondrial RNA

    • Method: RT-qPCR with primers spanning mitochondrial transcription units

    • Approach: Northern blotting with strand-specific probes for polycistronic transcripts

  • Mitochondrial Isolation and Protein Analysis:

    • Challenge: Obtaining pure mitochondrial fractions

    • Solution: Differential centrifugation followed by density gradient purification

    • Quality control: Assessing purity using markers for different cellular compartments

    • Consideration: Gentle lysis methods to preserve mitochondrial integrity

  • Functional Studies:

    • Challenge: Distinguishing NAD6 function from other Complex I components

    • Solution: In vitro reconstitution of Complex I with purified components

    • Method: Substrate-specific activity assays for different segments of the electron transport chain

    • Approach: Site-directed mutagenesis of conserved residues to identify functional domains

Research has shown that C. albicans mitochondrial DNA encodes 14 protein-coding genes organized into eight polycistronic transcription units . NAD6 (encoded by CaalfMp02) is part of this mitochondrial genome and is transcribed as part of a polycistronic RNA unit . Understanding this genomic organization is crucial for designing experiments to study NAD6 expression and regulation in the context of mitochondrial transcription and translation.

How can computational approaches enhance NAD6 research?

Computational methods offer powerful tools for understanding NAD6 structure, function, and evolution:

Computational Approaches:

  • Structural Prediction and Analysis:

    • Homology modeling based on related proteins with known structures

    • Ab initio modeling for unique regions without structural homologs

    • Molecular dynamics simulations to study conformational dynamics

    • Protein-ligand docking to identify potential inhibitor binding sites

  • Evolutionary Analysis:

    • Comparative genomics to identify conserved residues across fungal species

    • Phylogenetic analysis to trace the evolution of NAD6 in different fungi

    • Selection pressure analysis to identify functionally important residues

    • Coevolution analysis to predict interacting partners

  • Systems Biology Integration:

    • Metabolic modeling to predict the impact of NAD6 dysfunction

    • Network analysis to position NAD6 within cellular pathways

    • Multi-omics data integration (transcriptomics, proteomics, metabolomics)

    • Machine learning approaches to predict phenotypic outcomes of mutations

  • Drug Discovery Applications:

    • Virtual screening against NAD6 structural models

    • Fragment-based drug design targeting unique features

    • Pharmacophore modeling based on functional characteristics

    • Molecular dynamics simulations to study inhibitor interactions

The significance of computational approaches is highlighted by the identification of fungal-specific features in Complex I that are not present in mammals . These unique features, including NAD6, represent potential targets for antifungal development. Computational methods can identify specific structural and functional characteristics that distinguish fungal NAD6 from mammalian mitochondrial proteins, guiding experimental design and drug discovery efforts.

How might NAD6 serve as a target for novel antifungal therapeutics?

NAD6 represents a promising target for antifungal development due to several advantageous characteristics:

  • Selective Targeting Potential:

    • NAD6 has no direct homolog in mammalian cells, allowing for fungal-specific inhibition

    • The protein is essential for optimal respiratory function in C. albicans

    • Targeting NAD6 would disrupt energy metabolism in environments where respiration is required

  • Drug Discovery Strategies:

    • Structure-based design targeting unique features of fungal NAD6

    • High-throughput screening using recombinant protein in activity assays

    • Fragment-based approaches to identify lead compounds

    • Peptide inhibitors designed to disrupt Complex I assembly

  • Potential Advantages as an Antifungal Target:

    • May overcome existing resistance mechanisms to current antifungals

    • Could be effective against biofilms where metabolic flexibility is important

    • Potential for combination therapy with existing antifungals

    • May impair virulence without necessarily killing the fungus (anti-virulence approach)

  • Experimental Approaches for Validation:

    • Chemical genetic screening to identify compounds affecting NAD6 function

    • Allosteric inhibitor design targeting protein-protein interactions

    • Development of in vitro assays for high-throughput screening

    • Animal models to validate in vivo efficacy of NAD6 inhibitors

Research has demonstrated that Complex I proteins like NAD6 play critical roles in C. albicans cell biology and pathogenesis . The absence of these proteins in mammals makes them attractive targets for drug discovery efforts that could lead to novel antifungal therapeutics with reduced host toxicity. This is particularly important given the rising incidence of antifungal resistance and the limited number of antifungal drug classes currently available.

What are emerging technologies that could enhance NAD6 research?

Several cutting-edge technologies hold promise for advancing our understanding of NAD6 function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural determination of complete fungal Complex I

    • Visualization of NAD6 within its native complex

    • Conformational changes during electron transport

    • Comparative structural analysis between fungal and mammalian complexes

  • Single-Cell Technologies:

    • Single-cell RNA-seq to study NAD6 expression heterogeneity

    • Single-cell proteomics to examine protein levels across populations

    • Microfluidic devices for monitoring mitochondrial function in individual cells

    • Correlative light and electron microscopy for spatial context

  • Genome Editing Advances:

    • Mitochondrial-targeted CRISPR systems for direct mtDNA editing

    • Base editing technologies for introducing precise mutations

    • Inducible knockdown systems for temporal control of expression

    • Synthetic biology approaches for redesigning mitochondrial pathways

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for visualizing mitochondrial dynamics

    • FRET-based sensors for monitoring NAD6 interactions

    • Label-free imaging technologies for studying native complexes

    • Correlative light and electron microscopy for structural-functional analysis

  • Artificial Intelligence Applications:

    • Machine learning for predicting protein-protein interactions

    • Deep learning for image analysis of mitochondrial morphology

    • AI-driven drug discovery targeting NAD6

    • Automated literature mining for hypothesis generation

These emerging technologies will enable researchers to address complex questions about NAD6 function, regulation, and potential as a therapeutic target. The combination of structural, genetic, and functional approaches will provide a comprehensive understanding of this critical mitochondrial protein and its role in C. albicans biology.

How does NAD6 function compare across different Candida species and other pathogenic fungi?

Comparative analysis of NAD6 across fungal species reveals important evolutionary and functional insights:

Comparative Analysis Table: NAD6 Features Across Fungal Species

SpeciesNAD6 PresentComplex I FunctionRespiratory DependenceNotable Features
C. albicansYesCompleteModerateMetabolically flexible, can use both respiratory and fermentative metabolism
C. glabrataNoAbsentLowLacks Complex I, more similar to S. cerevisiae in energy metabolism
C. parapsilosisYesCompleteHighHigher reliance on respiratory metabolism than C. albicans
S. cerevisiaeNoAbsentVery LowUses alternative NADH:ubiquinone oxidoreductase (NDI1)
A. fumigatusYesCompleteHighComplex I essential for virulence
C. neoformansYesCompleteHighComplex I important for stress resistance

Research Implications:

  • Evolutionary Considerations:

    • Complex I was lost in Saccharomyces lineage approximately 100 million years ago

    • This evolutionary event was likely advantageous for fermentative lifestyle

    • NAD6 conservation in pathogenic fungi suggests importance for host adaptation

    • Selective pressure analysis can identify functionally critical residues

  • Functional Diversity:

    • NAD6 sequence variations may correspond to different environmental adaptations

    • Some species show alternative splicing or processing of NAD6 transcripts

    • Post-translational modifications may differ across species

    • Assembly of Complex I may involve species-specific chaperones

  • Methodological Approaches for Comparative Studies:

    • Heterologous expression of NAD6 from different species

    • Complementation studies in knockout strains

    • Chimeric proteins to identify functional domains

    • Comparative proteomics of purified Complex I

  • Significance for Pathogenesis:

    • Correlation between NAD6 function and virulence across species

    • Host niche specialization may relate to respiratory capacity

    • Differential importance during various infection stages

    • Species-specific inhibitor sensitivity could inform therapeutic strategies

The understanding that C. albicans possesses Complex I while S. cerevisiae does not highlights the evolutionary divergence that occurred approximately 100 million years ago . This difference likely reflects the ecological adaptation of different yeast species, with pathogenic Candida maintaining Complex I for metabolic flexibility during host infection. Comparative analysis across fungal pathogens provides valuable insights for both basic biology and therapeutic development.

What are the key takeaways for researchers working with recombinant NAD6?

Researchers working with recombinant Candida albicans NAD6 should consider several critical factors for successful experimental design and implementation:

The unique features of NAD6 as a mitochondrially-encoded Complex I component make it an intriguing subject for both basic research and applied studies. Its role in C. albicans metabolism and potential as an antifungal target highlight the importance of continued investigation into this protein and its functions.

How can researchers integrate NAD6 studies into broader investigations of fungal mitochondrial function?

NAD6 research can be effectively integrated into comprehensive studies of fungal mitochondrial biology:

  • Systems Biology Frameworks:

    • Position NAD6 within the broader context of mitochondrial function

    • Integrate transcriptomic, proteomic, and metabolomic data

    • Map interactions between nuclear and mitochondrial genetic systems

    • Develop mathematical models of respiratory chain function

  • Evolutionary Perspectives:

    • Compare mitochondrial gene organization across fungal lineages

    • Study the co-evolution of nuclear and mitochondrial Complex I components

    • Investigate the selective pressures that maintain Complex I in pathogenic fungi

    • Explore the functional consequences of Complex I loss in Saccharomyces

  • Host-Pathogen Interaction Studies:

    • Examine how mitochondrial function influences virulence traits

    • Investigate adaptation to host microenvironments (oxygen levels, nutrient availability)

    • Study mitochondrial dynamics during phagocyte interactions

    • Explore links between metabolism and immune evasion strategies

  • Interdisciplinary Collaboration Opportunities:

    • Structural biologists for complex assembly studies

    • Chemical biologists for probe development

    • Computational scientists for modeling approaches

    • Clinical mycologists for translational applications

Understanding NAD6 in the context of C. albicans mitochondrial function has broader implications for fungal biology and pathogenesis. The presence of functional Complex I in C. albicans compared to its absence in S. cerevisiae represents a fundamental difference in energy metabolism between these yeasts . This distinction likely influences their ecological niches and pathogenic potential, with C. albicans demonstrating greater metabolic flexibility that contributes to its success as a human pathogen.

What are the essential resources for NAD6 researchers?

Researchers working on NAD6 should be familiar with the following resources:

  • Protein and Gene Databases:

    • UniProt entry Q9B8D7 for C. albicans NAD6 protein sequence and annotations

    • Candida Genome Database (CGD) for genomic context and expression data

    • NCBI Protein and Gene databases for comparative analysis

    • PDB for structural information on related Complex I components

  • Experimental Protocols:

    • Protein expression and purification methodologies optimized for membrane proteins

    • Mitochondrial isolation techniques for C. albicans

    • Activity assays for NADH:ubiquinone oxidoreductase function

    • Genetic manipulation approaches for mitochondrial genes

  • Bioinformatics Tools:

    • TMHMM for transmembrane domain prediction

    • Clustal Omega for multiple sequence alignments

    • PyMOL or Chimera for structural visualization

    • KEGG for metabolic pathway mapping

  • Commercial Resources:

    • Recombinant NAD6 protein (Cat.No. RFL10944CF) for experimental standards

    • Antibodies for detection and immunoprecipitation

    • Specialized reagents for mitochondrial research

These resources provide essential tools and information for researchers studying NAD6 structure, function, and role in C. albicans biology. The combination of experimental and computational resources enables comprehensive investigation of this important mitochondrial protein.

What methodological advances are needed to overcome current limitations in NAD6 research?

Several methodological challenges in NAD6 research require innovative approaches:

  • Direct Mitochondrial Genome Editing:

    • Development of CRISPR-based systems that can target mitochondrial DNA

    • Improved mitochondrial transformation methods with higher efficiency

    • Site-specific recombination systems for mtDNA manipulation

    • Methods for selecting mitochondrial transformants

  • Structural Determination Approaches:

    • Optimization of membrane protein crystallization for Complex I components

    • Advanced Cryo-EM techniques for structure determination in native environment

    • Improved computational prediction methods for membrane protein structures

    • Development of fungal-specific nanobodies as crystallization chaperones

  • Functional Assessment Tools:

    • Real-time monitoring of Complex I activity in living cells

    • Mitochondria-specific biosensors for local environment sensing

    • Single-molecule techniques for studying individual protein dynamics

    • Label-free methods for detecting conformational changes

  • Translational Research Platforms:

    • High-throughput screening systems specifically designed for mitochondrial targets

    • Improved fungal infection models that recapitulate respiratory requirements

    • Patient-derived isolates for studying natural variation in NAD6 function

    • Pharmacokinetic optimization methods for mitochondria-targeting compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.