Recombinant Candida albicans Palmitoyltransferase ERF2 (ERF2)

Shipped with Ice Packs
In Stock

Description

Structure and Mechanism

Domain Architecture:

  • ERF2 contains four predicted transmembrane domains and a DHHC-CRD (cysteine-rich domain) motif essential for enzymatic activity .

  • The DHHC motif facilitates autopalmitoylation, forming a palmitoyl thioester intermediate before transferring the palmitate to substrate proteins like Ras GTPases .

Mechanistic Insights:

  • Palmitoylation occurs in two steps:

    1. Autopalmitoylation: The DHHC cysteine residue binds palmitoyl-CoA to form a palmitoyl-ERF2 intermediate.

    2. Substrate Transfer: The palmitoyl group is transferred to the target protein (e.g., Ras) .

  • ERF2 requires its auxiliary subunit ERF4 (or GCP16 in mammals) for stability and efficient substrate transfer. ERF4 prevents ERF2 degradation via ubiquitin-mediated pathways and reduces futile hydrolysis of the palmitoyl intermediate .

Functional Roles in Candida albicans

ERF2-mediated palmitoylation impacts:

  • Virulence: Proper localization of signaling proteins like Ras is critical for hyphal growth and host invasion .

  • Membrane Trafficking: Palmitoylation regulates vesicular transport and secretion of virulence factors .

  • Stress Response: ERF2 activity influences fungal adaptation to oxidative stress and host immune defenses .

Biochemical Characterization

PropertyDetailsSource
Expression SystemRecombinant ERF2 is produced in Pichia pastoris for functional studies .
Enzyme StabilityRequires storage at -20°C or -80°C; repeated freeze-thaw cycles degrade activity .
Catalytic EfficiencyERF4 subunit enhances ERF2 stability and reduces hydrolysis of the palmitoyl intermediate .

Substrate Specificity

  • ERF2 palmitoylates Ras-family GTPases, influencing their membrane localization .

  • In Fusarium oxysporum, homologs of ERF2 palmitoylate AP-2 complex subunits (α, β, μ), which regulate clathrin-mediated endocytosis—a process critical for fungal virulence .

Regulatory Mechanisms

  • Ubiquitination: ERF2 is degraded via ER-associated degradation (ERAD) in the absence of ERF4 .

  • Kinetic Behavior: ERF2 exhibits biphasic kinetics: rapid autopalmitoylation followed by steady-state substrate transfer .

Applications in Research

Recombinant ERF2 is used to:

  • Study fungal pathogenesis mechanisms, particularly Ras signaling and hyphal morphogenesis .

  • Screen antifungal agents targeting palmitoylation pathways .

  • Investigate evolutionary conservation of DHHC-PAT regulation across fungi .

Challenges and Future Directions

  • Structural Studies: No high-resolution structure of C. albicans ERF2 exists; homology modeling relies on yeast ERF2 .

  • Therapeutic Potential: Inhibiting ERF2-ERF4 interaction could disrupt fungal virulence without harming human cells .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
ERF2; CAALFM_C103920CA; CaO19.11946; CaO19.4466; Palmitoyltransferase ERF2; DHHC cysteine-rich domain-containing protein ERF2; Ras protein acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
ERF2
Target Protein Sequence
MDPNLISHYNNTNTRRFKNYQIENQGQSNFIYFLGGRLHTIKTKYPINLITLSLIIIPGI LYIIFELSWQWRNFSPIIVIIFLYIWIISIFHFFKLSTGDAGKLPKNIHLPKKLITITTT TTTTNDNEIDHRNNYKVRGSPPDEYFNTVTLPYWKTNNDNNDNTKISKLANAYHSHGVQV KYCGTCHIWRPSRTSHCNTCQQCILNHDHHCIFLNNCIGQRNYKFFLWFLLYIVIACLYL LIISILQLCHYKFASHKESEIITTFNQSIKTHPISLLLLIYSCLAICYPGLLLAFHIFLT SQNITTREYLNFVYKKPSKSTDGGDGTRGFVNVYNTHSIWENLYINWLGKSNGVSLTFPR DYYHQGDIRFANIEPLGTFTNK
Uniprot No.

Target Background

Function
The ERF2-ERF4 complex is a palmitoyltransferase specific for Ras proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of ERF2 palmitoyltransferase in Candida albicans?

ERF2 in Candida albicans likely functions similarly to its S. cerevisiae homolog as a DHHC protein acyltransferase that catalyzes protein palmitoylation. Based on studies in yeast, ERF2 forms a complex with an auxiliary protein (ERF4 in S. cerevisiae) to create a functional Ras Protein Acyltransferase (PAT) . This enzyme complex mediates the addition of palmitoyl groups to substrate proteins, particularly Ras family GTPases, via a thioester linkage on cysteine residues . The palmitoylation modification is reversible and plays critical roles in protein membrane targeting, receptor trafficking, vesicular biogenesis, and protein stability .

Does C. albicans ERF2 require a co-factor similar to Erf4 in S. cerevisiae?

Based on homology to the S. cerevisiae system, C. albicans ERF2 likely requires a co-factor similar to Erf4. In S. cerevisiae, Erf4 (also known as Shr5) is essential for Erf2's stability, autopalmitoylation, and palmitoyltransferase activity . Erf4 prevents Erf2 degradation via the ER quality control pathway (ERAD) and stabilizes the palmitoyl-Erf2 intermediate thioester during the enzymatic reaction . Even when Erf2 is stabilized through other means, the absence of Erf4 still results in non-functional enzyme, indicating multiple roles for this auxiliary subunit . Researchers working with recombinant C. albicans ERF2 should consider co-expressing the C. albicans Erf4 homolog to achieve functional enzyme activity.

What is the subcellular localization of ERF2 in Candida albicans?

While specific localization data for C. albicans ERF2 is not directly available in the provided search results, studies of the S. cerevisiae homolog indicate ERF2 is an integral membrane protein localized to the endoplasmic reticulum (ER) . The DHHC domain in ERF2 is positioned on the cytosolic face of the ER membrane, where it can interact with both palmitoyl-CoA and substrate proteins at the membrane-cytosol interface . This positioning is crucial for its enzymatic function as it allows access to both the palmitoyl-CoA substrate and target proteins requiring palmitoylation.

What is the molecular mechanism of ERF2-mediated protein palmitoylation?

ERF2-mediated protein palmitoylation follows a two-step ping-pong mechanism:

  • Autopalmitoylation step: The cysteine residue in the conserved DHHC motif of ERF2 reacts with palmitoyl-CoA to form a palmitoyl-enzyme intermediate, releasing free CoA-SH .

  • Transfer step: The palmitoyl group is transferred from the DHHC motif of ERF2 to a cysteine residue in the substrate protein .

This mechanism can result in either productive transfer to the substrate or hydrolysis (a "futile cycle") depending on the availability and conformation of substrate proteins . The auxiliary subunit (Erf4 in S. cerevisiae) stabilizes the palmitoyl-enzyme intermediate, reducing hydrolysis and increasing the likelihood of productive transfer to substrate proteins .

Recent structural studies of human ZDHHC20 (a homolog of yeast Erf2) show that the DHHC domain adopts a teepee-like structure with the active site positioned at the membrane-cytosol interface, ideally situated to interact with both palmitoyl-CoA and substrate proteins .

How does ERF2 select its substrate proteins in Candida albicans?

  • Spatial proximity: For integral membrane proteins, cysteines located within 8 angstroms of the membrane-cytosol interface are preferentially palmitoylated due to the positioning of the DHHC motif .

  • Substrate conformation: The binding conformation between ERF2 and its substrates appears critical for effective palmitoylation. Mutations distal to palmitoylation sites can significantly impact modification efficiency by altering this conformation .

  • Recognition motifs: While no universal consensus sequence for palmitoylation exists, certain amino acid patterns surrounding target cysteines may enhance recognition by specific DHHC enzymes.

Researchers should note that experimental trial-and-error remains essential for identifying specific palmitoylation sites within potential substrate proteins .

What is the regulatory relationship between ERF2 activity and cellular signaling pathways in fungal pathogens?

While the specific regulatory mechanisms for C. albicans ERF2 are not detailed in the search results, we can infer from related systems that ERF2-mediated palmitoylation likely influences several signaling pathways:

  • Ras signaling: In S. cerevisiae, Erf2-Erf4 palmitoylates Ras proteins, regulating their membrane localization and signaling capacity . This is likely conserved in C. albicans, where Ras signaling controls morphogenesis and virulence.

  • Post-translational modification crosstalk: In some systems, phosphorylation can regulate substrate recognition by DHHC enzymes. For example, ATR-mediated phosphorylation enhances the association between ZDHHC13 and its substrate MC1R . Similar regulatory mechanisms may exist for C. albicans ERF2.

  • Metabolic influence: Palmitoylation depends on palmitoyl-CoA availability, which links ERF2 activity to fatty acid metabolism . Changes in cellular metabolism during host infection may alter ERF2 substrate palmitoylation patterns.

What expression systems are most effective for producing active recombinant C. albicans ERF2?

While the search results don't specifically address expression systems for C. albicans ERF2, several approaches can be recommended based on related enzyme expression:

  • Pichia pastoris expression system: This yeast expression system has been successfully used for recombinant production of C. albicans mannosyltransferases (Mnt1, Mnt2, and Mnt5) . As a eukaryotic system, P. pastoris provides appropriate post-translational modifications and membrane environments for membrane-bound enzymes like ERF2.

  • Co-expression considerations: Since ERF2 likely requires an auxiliary protein (ERF4 homolog) for stability and activity, co-expression of both proteins is recommended . Expression constructs should be designed to ensure proper stoichiometry of these interacting partners.

  • Membrane protein considerations: As an integral membrane protein, ERF2 requires specific extraction and purification approaches. Detergent screening is essential for maintaining enzyme structure and activity during purification.

How can ERF2 palmitoyltransferase activity be measured in vitro?

Based on established methods for measuring DHHC palmitoyltransferase activity, the following approaches can be adapted for C. albicans ERF2:

  • Autopalmitoylation assay: Using [³H]-palmitoyl-CoA or [¹⁴C]-palmitoyl-CoA as substrate and detecting incorporation of radioactivity into purified ERF2 protein. This assesses the first step of the palmitoylation reaction .

  • Transfer assay: Measuring transfer of radiolabeled palmitate from ERF2 to purified substrate proteins (e.g., Ras). This evaluates the complete palmitoyltransferase reaction .

  • Hydrolysis assay: Monitoring the rate of palmitoyl-CoA hydrolysis in the presence of ERF2, with or without substrate proteins. This can be used to assess the balance between productive transfer and futile cycling .

  • Click chemistry approaches: Using alkyne-modified palmitate analogs that can be coupled to fluorescent or affinity tags via click chemistry, allowing non-radioactive detection of palmitoylated proteins.

When designing these assays, researchers should consider including the ERF4 homolog, as it significantly impacts both the stability of ERF2 and the efficiency of the palmitoylation reaction .

What mutations can be introduced to study structure-function relationships in C. albicans ERF2?

Based on studies of DHHC palmitoyltransferases, several key mutations can be introduced to investigate ERF2 function:

  • DHHC motif mutations: The cysteine in the DHHC motif is essential for catalysis. Mutation to serine (DHHS) would create a catalytically inactive enzyme that could still bind substrates, useful for substrate-trapping experiments .

  • Transmembrane domain mutations: Alterations in the transmembrane domains could affect the orientation of the DHHC domain relative to the membrane, potentially altering substrate specificity.

  • Erf4-interaction domain mutations: Identifying and mutating residues involved in the interaction with the ERF4 homolog would help elucidate the molecular basis of this regulatory interaction .

  • Ubiquitination site mutations: In S. cerevisiae, Erf2 undergoes ubiquitin-mediated degradation in the absence of Erf4 . Identifying and mutating these ubiquitination sites could generate more stable variants of the enzyme for structural studies.

What is the relationship between ERF2 function and Candida albicans virulence?

While the search results don't directly address C. albicans ERF2's role in virulence, we can make educated inferences:

  • Ras signaling in pathogenicity: If C. albicans ERF2 palmitoylates Ras proteins similar to S. cerevisiae Erf2, it would likely influence Ras-dependent virulence traits such as hyphal morphogenesis, biofilm formation, and stress response .

  • Protein trafficking: Palmitoylation regulates the trafficking of many proteins to the cell surface. Disruption of ERF2 function could affect the localization of virulence factors and cell wall proteins that mediate host-pathogen interactions.

  • Cell wall organization: Proper localization of cell wall biosynthetic enzymes may depend on palmitoylation. ERF2 dysfunction could alter cell wall composition, affecting antifungal susceptibility and immune recognition.

Researchers studying C. albicans ERF2's role in virulence should consider both direct substrate effects and the broader impact on cellular organization and signaling networks.

Could inhibitors of ERF2 serve as potential antifungal agents?

Based on insights from DHHC palmitoyltransferase inhibition in other contexts, ERF2 could represent a promising antifungal target:

  • Pathway specificity: If C. albicans ERF2 has a substrate profile distinct from human DHHC enzymes, selective inhibition might be possible, reducing off-target effects .

  • Synergistic potential: In cancer research, inhibition of palmitoylation has shown synergistic effects with other targeted therapies . Similarly, ERF2 inhibitors might synergize with existing antifungals, potentially overcoming resistance mechanisms.

  • Challenges: Developing highly specific inhibitors may be difficult due to the conserved catalytic mechanism of DHHC enzymes. Additionally, redundancy among palmitoyltransferases might limit the efficacy of targeting a single enzyme.

When screening for ERF2 inhibitors, researchers should consider both competitive inhibitors that target the palmitoyl-CoA binding site and allosteric inhibitors that disrupt the ERF2-ERF4 interaction or substrate recognition.

How does C. albicans ERF2 compare to its homologs in other fungal species?

While specific comparative data is not provided in the search results, several points of comparison are likely relevant:

  • Saccharomyces cerevisiae: The S. cerevisiae Erf2-Erf4 complex is well-characterized as a Ras palmitoyltransferase . C. albicans ERF2 likely shares significant structural and functional similarity but may have evolved substrate preferences relevant to C. albicans biology and pathogenesis.

  • Substrate specificity: Different fungal species may have evolved distinct substrate profiles for their DHHC enzymes, reflecting their ecological niches and life cycles. C. albicans ERF2 might preferentially palmitoylate proteins involved in host-pathogen interactions.

  • Regulation: The regulation of ERF2 activity may differ between commensal and pathogenic fungi, potentially tied to virulence mechanisms in C. albicans.

A phylogenetic analysis of DHHC proteins across fungal species, combined with experimental validation of substrate preferences, would provide valuable insights into the evolution and specialization of these enzymes.

How does fungal ERF2 differ from human DHHC palmitoyltransferases?

Understanding differences between fungal ERF2 and human DHHC enzymes is crucial for therapeutic development:

Comparative structural and biochemical studies would help identify unique features of fungal ERF2 that could be exploited for antifungal development.

What are common pitfalls when working with recombinant ERF2 and how can they be addressed?

Based on challenges reported with DHHC palmitoyltransferases and membrane proteins, researchers should anticipate:

  • Protein instability: Like S. cerevisiae Erf2, C. albicans ERF2 may be unstable without its auxiliary protein partner . Co-expression with the ERF4 homolog is likely essential for obtaining stable, active enzyme.

  • Detergent sensitivity: As a membrane protein, ERF2 activity is highly dependent on the lipid/detergent environment. Systematic detergent screening is recommended to identify conditions that maintain native structure and activity.

  • Autopalmitoylation vs. transfer activity: Distinguishing between these two activities is crucial for accurate assessment of ERF2 function. Controls should include catalytically inactive mutants and assays that separately measure autopalmitoylation and transfer steps .

  • Substrate conformation: The conformation of substrate proteins significantly impacts palmitoylation efficiency . Ensure substrate proteins are properly folded and in an appropriate buffer environment for interaction with ERF2.

How can researchers optimize protein-protein interaction studies involving ERF2?

When investigating ERF2 interactions with its auxiliary protein or substrates:

  • Membrane-based interaction systems: Consider split-ubiquitin or split-GFP systems designed for membrane protein interactions rather than traditional yeast two-hybrid assays.

  • In situ proximity labeling: Techniques like BioID or APEX2 can identify proteins in close proximity to ERF2 in living cells, potentially revealing novel substrates or regulators.

  • Co-immunoprecipitation approaches: Use mild detergents that preserve membrane protein interactions, and consider crosslinking to stabilize transient interactions with substrate proteins.

  • Surface plasmon resonance adaptations: For quantitative binding studies, consider capturing ERF2 in nanodiscs or liposomes for SPR analysis of interactions with soluble domains of substrate proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.