Recombinant Candida albicans Palmitoyltransferase PFA3 (PFA3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PFA3; CAALFM_C306990WA; CaO19.14094; CaO19.6802; Palmitoyltransferase PFA3; Protein fatty acyltransferase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
PFA3
Target Protein Sequence
MAAILYKYPMATNNNNNNGNPILRSLETSCCFLATLFPKVFCTLVLTWSLYVLLFIIPNY IKSSLNSTILNIIGITLYVLCIISYYKIILIGPGSPLDYPELRINDLNRMINENPYNNNN NDEEPGDLPPESMIIHTMKVNGNQGYRYCTKCSVWKPDRSHHCSSSGKCILKMDHYCPWF STCIGFHNYKFFIQFLSYVAIYCWFLFIISGKILYNFITEGLFEDEILSLNLVAVLILSF AFAIAVSVFAMFSIYLCCKNLTTIEFQEKRWNYRGQANDERFNYEFDNNGKRKKINTNIF DLGIMENWKSVMGPNWITWILPITVTVTANTKSMISQDEFNNGVNFKVNEEIYAKYLHNA ELQQQLNQQLSSYKDRLRRERQANIV
Uniprot No.

Target Background

Function
A palmitoyltransferase specific to VAC8. It palmitoylates VAC8 at one or more N-terminal cysteine residues, a process crucial for its accurate membrane localization.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA3 subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is Candida albicans Palmitoyltransferase PFA3 and what is its primary function?

Candida albicans Palmitoyltransferase PFA3 (PFA3) is a DHHC-CRD protein that functions as a protein acyltransferase. Based on research findings, PFA3 plays a critical role in vacuole fusion processes within C. albicans cells . As a member of the protein fatty acyltransferase family, PFA3 catalyzes the addition of fatty acid groups (primarily palmitate) to specific protein substrates, which affects their membrane association, stability, and functionality. This post-translational modification is essential for various cellular processes including proper vacuolar function and membrane dynamics.

How does PFA3 differ from other protein acyltransferases in Candida albicans?

PFA3 is distinguished from other protein acyltransferases in Candida albicans primarily by its specific subcellular localization and substrate specificity. Research has demonstrated that PFA3 localizes specifically to the vacuolar membrane, as confirmed by fluorescence microscopy using GFP-tagged PFA3 proteins that show codistribution with vacuolar membrane markers like FM 4-64 . This vacuolar localization suggests a specialized role in vacuolar protein modification and function that differs from other acyltransferases that may be located in different cellular compartments. While other acyltransferases may target proteins involved in hyphal formation or cell wall integrity, PFA3's vacuolar association indicates its specialized role in vacuole-related processes.

What is the genomic organization of the PFA3 gene in Candida albicans?

The PFA3 gene in Candida albicans encodes a protein with the characteristic DHHC-CRD (Asp-His-His-Cys cysteine-rich domain) that defines this family of protein acyltransferases. While specific information about the genomic organization of PFA3 in C. albicans is limited in the provided search results, research on related protein acyltransferases suggests that these genes typically contain regions coding for multiple transmembrane domains and the catalytic DHHC-CRD domain that is essential for palmitoyltransferase activity. The gene structure likely includes regulatory regions that control its expression in response to changes in cellular conditions that affect vacuolar function.

How is PFA3 involved in Candida albicans vacuole fusion processes?

PFA3 has been demonstrated to be important for vacuole fusion in Candida albicans, functioning as a DHHC-CRD protein that mediates protein palmitoylation . The palmitoylation of vacuolar membrane proteins by PFA3 likely facilitates proper protein-protein interactions and membrane organization required for the complex process of vacuole fusion. Research indicates that disruption of PFA3 function can impair normal vacuolar morphology and fusion events, suggesting its critical role in maintaining vacuolar homeostasis. The palmitoylation activity of PFA3 may regulate the lateral organization of proteins within the vacuolar membrane, creating specialized membrane microdomains that serve as platforms for the fusion machinery.

What techniques are used to visualize PFA3 localization in Candida albicans cells?

Researchers have successfully visualized PFA3 localization using fluorescence microscopy with C-terminally tagged PFA3 proteins. Specifically, a 3xGFP tag has been integrated into the PFA3 locus to create a C-terminally tagged protein (PFA3-3xGFP) . This approach allows for direct visualization of PFA3 within living cells. To confirm vacuolar localization, co-localization studies are performed using the lipophilic dye FM 4-64, which specifically stains vacuolar membranes. The observed co-distribution of PFA3-3xGFP with FM 4-64 provides strong evidence for the vacuolar membrane localization of PFA3 . Additional techniques that might be employed include immunofluorescence microscopy with antibodies against PFA3 or subcellular fractionation followed by Western blotting.

What role does PFA3 play in Candida albicans pathogenicity and biofilm formation?

While the search results don't directly address PFA3's role in pathogenicity and biofilm formation, we can infer potential connections based on what we know about C. albicans biology and the importance of vacuolar function. Proper vacuolar function, which PFA3 helps maintain through its role in vacuole fusion , is likely important for stress responses and adaptation to host environments. C. albicans is known to form polymicrobial biofilms with various bacteria both in vitro and in vivo, and these biofilms impact disease course and management . The altered expression of genes involved in cell wall integrity, adhesion, and hyphal formation often influences biofilm formation. While other genes like SAP9, ALS3, and HWP1 have been directly linked to biofilm formation , the specific contribution of PFA3 requires further investigation.

What expression systems are most effective for producing recombinant Candida albicans PFA3?

For producing recombinant Candida albicans PFA3, researchers typically employ either heterologous expression systems or endogenous expression approaches. While the search results don't specify preferred expression systems for PFA3 specifically, common approaches for membrane proteins like PFA3 include:

  • Endogenous Expression: Integrating epitope tags (such as GFP or FLAG) at the genomic locus, as demonstrated with the 3xGFP tag integration into the PFA3 locus . This approach maintains native regulation and expression levels.

  • Heterologous Expression: For larger quantities of protein, heterologous expression in systems such as:

    • Escherichia coli with specialized strains optimized for membrane protein expression

    • Saccharomyces cerevisiae for eukaryotic post-translational modifications

    • Pichia pastoris for high-yield expression of difficult eukaryotic proteins

For functional studies, maintaining the correct membrane topology and post-translational modifications is critical, making yeast-based expression systems generally preferable for DHHC-domain proteins like PFA3.

What purification strategies yield the highest activity for recombinant PFA3?

Purifying recombinant PFA3 with maintained activity requires careful consideration of its membrane-bound nature and enzymatic properties. While specific purification protocols for PFA3 aren't detailed in the search results, optimal approaches typically include:

Table 1: Recommended Purification Strategies for Membrane-Associated Acyltransferases

Purification StageRecommended ApproachCritical Considerations
Cell DisruptionGentle mechanical disruption or enzymatic spheroplastingMinimize protein denaturation
Membrane ExtractionDetergent solubilization (DDM, CHAPS, or Triton X-100)Use detergent concentrations that solubilize without denaturing
Initial CaptureMetal affinity chromatography (if His-tagged)Include detergent in all buffers
Intermediate PurificationIon exchange chromatographyMaintain pH away from protein pI
PolishingSize exclusion chromatographyRemove aggregates and detergent micelles
StorageInclude glycerol (10-20%) and reducing agentPrevent oxidation of critical cysteine residues

For activity preservation, it's crucial to maintain the integrity of the DHHC-CRD domain by including reducing agents throughout purification and avoiding harsh conditions that might disrupt this catalytic domain.

How can I design effective assays to measure PFA3 palmitoyltransferase activity?

Designing effective assays for PFA3 palmitoyltransferase activity requires methods that can detect the transfer of palmitate to substrate proteins. While specific assay protocols for PFA3 aren't detailed in the search results, standard approaches for assessing DHHC-domain protein activity include:

  • Metabolic Labeling: Incubating cells expressing PFA3 with radioactive palmitate (³H or ¹⁴C-labeled) followed by immunoprecipitation of potential substrate proteins and detection via fluorography.

  • Click Chemistry-Based Assays: Using alkyne or azide-modified palmitate analogs that can be conjugated to fluorescent or affinity tags after incorporation.

  • Direct In Vitro Assays:

    • Incubating purified PFA3 with potential substrates and palmitoyl-CoA

    • Detecting palmitate transfer through:

      • Mass spectrometry to identify modified peptides

      • Acyl-biotin exchange (ABE) chemistry to detect palmitoylated cysteines

      • Mobility shift assays that detect changes in protein migration due to palmitoylation

The choice of assay depends on whether you're investigating known or novel substrates and whether you're working in cellular or purified protein contexts.

How does the DHHC-CRD domain of PFA3 compare structurally with other palmitoyltransferases?

The DHHC-CRD (Asp-His-His-Cys cysteine-rich domain) is the catalytic core of palmitoyltransferases including PFA3. While the search results don't provide specific structural comparisons of PFA3's DHHC domain, research on palmitoyltransferases suggests several conserved features:

The DHHC domain typically follows a pattern where the aspartate-histidine-histidine-cysteine motif resides within a cysteine-rich region that coordinates zinc ions, essential for catalytic activity. Variations in the amino acid sequences flanking this core motif likely contribute to differences in substrate specificity between different palmitoyltransferases. Additionally, most DHHC proteins, including PFA3, contain multiple transmembrane domains that anchor the protein in the membrane and position the DHHC-CRD domain properly for catalysis.

Structural studies of DHHC proteins reveal a conserved catalytic mechanism involving an acyl-enzyme intermediate where the palmitoyl group is first transferred to the cysteine in the DHHC motif before being transferred to the substrate protein. The specific orientation of PFA3's DHHC domain within the vacuolar membrane likely influences its accessibility to substrate proteins and contributes to its specificity.

What is the substrate specificity of PFA3 and how is it determined?

The substrate specificity of PFA3 is likely determined by a combination of factors including the structural features of the DHHC-CRD domain, the protein's localization to the vacuolar membrane, and specific protein-protein interaction domains. While the search results don't detail the specific substrates of PFA3, research on palmitoyltransferases suggests several factors that influence substrate recognition:

  • Spatial co-localization: PFA3's vacuolar membrane localization means it likely targets proteins that are transiently or permanently associated with the vacuole.

  • Recognition motifs: Substrate proteins often contain specific sequences or structural motifs that are recognized by the palmitoyltransferase.

  • Accessibility of cysteine residues: Palmitoylation occurs on cysteine residues, typically located near transmembrane domains or in regions that interact with membranes.

Given PFA3's role in vacuole fusion , likely substrates include SNARE proteins and other fusion machinery components that require palmitoylation for proper function within the vacuolar membrane. Identifying the complete substrate profile of PFA3 would typically involve proteomic approaches comparing palmitoylated proteins in wild-type and PFA3-deficient strains.

How does PFA3 function differ between hyphal and yeast forms of Candida albicans?

The difference in PFA3 function between hyphal and yeast forms of Candida albicans represents an important area of investigation, though the search results don't directly address this question. Based on what we know about C. albicans biology, several hypotheses can be formulated:

During the morphological transition from yeast to hyphal forms, C. albicans undergoes significant remodeling of cellular structures, including the vacuolar system. Given PFA3's role in vacuole fusion , its activity and expression might be differentially regulated during this transition to accommodate the changing cellular architecture. The elongated hyphal cells may require different patterns of vacuolar organization compared to the more compact yeast cells, potentially necessitating altered PFA3 activity.

It has been observed that hyphal formation can influence the expression of virulence-associated genes and the formation of polymicrobial biofilms . The search results indicate that biofilms with more hyphae had larger biomass and resulted in increased expression of bacterial virulence-associated genes . While PFA3 isn't specifically mentioned in this context, its potential role in supporting the vacuolar changes during hyphal formation warrants investigation.

Experimental approaches to address this question would include comparing PFA3 expression levels, localization patterns, and substrate profiles between yeast and hyphal forms using techniques such as RT-qPCR, fluorescence microscopy with tagged PFA3, and comparative proteomics.

What are common challenges in expressing recombinant PFA3 and how can they be addressed?

Expressing recombinant PFA3 presents several challenges typical of membrane-associated acyltransferases. While the search results don't detail specific expression challenges for PFA3, researchers working with similar proteins often encounter:

  • Protein Misfolding and Aggregation: DHHC-domain proteins can misfold when overexpressed, forming inactive aggregates.

    • Solution: Reduce expression temperature and use specialized expression strains designed for membrane proteins.

  • Low Expression Yields: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for the expression host and consider fusion tags that enhance expression and solubility.

  • Toxicity to Host Cells: Overexpression of membrane proteins can disrupt host cell membrane integrity.

    • Solution: Use tightly regulated inducible promoters and optimize induction conditions.

  • Improper Post-translational Modifications: Bacterial expression systems may lack the machinery for eukaryotic modifications.

    • Solution: Consider using yeast expression systems like S. cerevisiae or P. pastoris that provide an environment more similar to the native one.

  • Maintaining Enzymatic Activity: The catalytic DHHC domain contains essential cysteine residues that are sensitive to oxidation.

    • Solution: Include reducing agents in all buffers and minimize exposure to oxidizing conditions.

The successful expression of PFA3 with a 3xGFP tag in its native context suggests that C-terminal tagging is tolerated and could be a viable approach for recombinant expression systems as well.

How can researchers overcome difficulties in detecting palmitoylation of PFA3 substrates?

Detecting protein palmitoylation presents technical challenges due to the labile nature of the thioester bond and the hydrophobicity of the palmitate group. While the search results don't specifically address detection methods for PFA3 substrates, several strategies can overcome common difficulties:

  • Poor Signal-to-Noise Ratio:

    • Solution: Enhance specificity using the Acyl-Biotin Exchange (ABE) or acyl-RAC (resin-assisted capture) methods, which convert palmitoylated cysteines to biotinylated cysteines for specific detection.

  • Transient or Dynamic Palmitoylation:

    • Solution: Use pulse-chase experiments with metabolic labeling to capture the dynamics of palmitoylation/depalmitoylation cycles.

  • Low Abundance of Palmitoylated Proteins:

    • Solution: Employ enrichment strategies such as streptavidin affinity purification following ABE chemistry before mass spectrometry analysis.

  • Distinguishing PFA3-Specific Substrates from Those Modified by Other Palmitoyltransferases:

    • Solution: Perform comparative analyses using PFA3 knockout/knockdown strains or specific inhibitors of PFA3 activity.

  • False Positives from Non-Specific Labeling:

    • Solution: Include stringent controls including treatment with hydroxylamine (which cleaves thioester bonds) to confirm the specificity of palmitoylation signals.

These approaches can be combined with proteomic analyses focusing on vacuolar membrane proteins, which are more likely to be PFA3 substrates given its vacuolar localization .

What strategies can resolve contradictory findings about PFA3 function in different experimental models?

Resolving contradictory findings about PFA3 function across different experimental models requires systematic investigation of the variables that might contribute to discrepancies. Although the search results don't mention specific contradictions regarding PFA3, this is a common challenge in research that can be addressed through:

  • Standardization of Experimental Conditions:

    • Develop consistent protocols for strain cultivation, protein expression, and functional assays

    • Document media composition, growth phase, and environmental factors that might influence results

  • Strain-Specific Differences:

    • Create isogenic strains that differ only in PFA3 status to eliminate background genetic variation

    • Validate key findings across multiple independent C. albicans isolates

  • Method-Dependent Artifacts:

    • Compare results from complementary methodological approaches

    • For example, if discrepancies exist between in vitro and in vivo findings, develop intermediate models like organotypic cultures

  • Integration of Multiple Data Types:

    • Combine genetic, biochemical, microscopic, and phenotypic analyses to build a more complete picture

    • Use computational modeling to reconcile apparently contradictory data points

  • Context-Dependent Function:

    • Investigate whether PFA3 function varies under different physiological or stress conditions

    • Explicitly test whether findings from one context (e.g., laboratory growth) translate to another (e.g., biofilm formation)

The discrepancy observed in interactions between C. albicans and P. aeruginosa in static versus flow conditions demonstrates how experimental setup can dramatically affect results. Similarly, findings about PFA3 might vary depending on whether studies are conducted in planktonic cultures, biofilms, or in vivo infection models.

What are promising approaches for identifying all physiological substrates of PFA3 in Candida albicans?

Identifying the complete substrate profile of PFA3 in Candida albicans requires comprehensive approaches that combine genetic, biochemical, and proteomic techniques. While the search results don't detail specific substrate identification methods for PFA3, cutting-edge approaches include:

  • Global Palmitoylome Analysis:

    • Compare wild-type and PFA3-deficient strains using palmitoylomic approaches like:

      • Acyl-biotin exchange (ABE) coupled with mass spectrometry

      • Metabolic labeling with palmitate analogs followed by click chemistry and proteomics

    • Focus especially on vacuolar membrane proteins given PFA3's localization

  • Proximity-Based Labeling:

    • Create fusion proteins of PFA3 with promiscuous biotin ligases (BioID) or peroxidases (APEX)

    • These enzymes biotinylate proteins in close proximity to PFA3, potentially including transient substrates

  • Substrate Trapping Mutants:

    • Engineer catalytically inactive PFA3 variants that bind but don't release substrates

    • Immunoprecipitate these variants to identify trapped potential substrates

  • Bioinformatic Prediction Combined with Validation:

    • Develop algorithms to predict palmitoylation sites in vacuolar proteins

    • Validate predictions experimentally using site-directed mutagenesis

  • Temporal Analysis During Vacuole Fusion:

    • Monitor palmitoylation dynamics during induced vacuole fusion events

    • Identify proteins whose palmitoylation status changes in a PFA3-dependent manner

These approaches would provide valuable insights into how PFA3 influences vacuolar function and potentially other cellular processes in C. albicans.

How might inhibitors of PFA3 affect Candida albicans pathogenicity and biofilm formation?

Exploring the potential of PFA3 inhibitors as antifungal agents represents an interesting research direction. While the search results don't directly address PFA3 inhibition, we can consider several aspects:

Given PFA3's role in vacuole fusion , inhibiting its activity might disrupt vacuolar homeostasis and potentially affect C. albicans stress responses and adaptation to host environments. Since proper vacuolar function is important for cellular stress responses, PFA3 inhibition might sensitize C. albicans to existing antifungal drugs or host defense mechanisms.

The impact on biofilm formation could be particularly significant. C. albicans forms polymicrobial biofilms with various bacteria, which impact disease course and management . If PFA3 inhibition affects hyphal formation or the expression of adhesins, it could potentially reduce biofilm formation, though this connection requires experimental validation.

Research approaches to investigate this question would include:

  • Developing specific PFA3 inhibitors through structure-based drug design

  • Testing these inhibitors in biofilm formation assays

  • Evaluating combinatorial effects with existing antifungals

  • Assessing impacts on virulence in animal infection models

The efficacy of such inhibitors would need to be balanced against potential off-target effects on host palmitoyltransferases and carefully evaluated for therapeutic potential.

What is the evolutionary significance of PFA3 conservation across fungal species?

The evolutionary conservation of PFA3 across fungal species likely reflects its fundamental importance in cellular processes. While the search results don't specifically address the evolutionary aspects of PFA3, examining its conservation pattern could reveal important insights:

DHHC-domain palmitoyltransferases are found across eukaryotes, suggesting ancient origins for this protein family. The specific conservation patterns of PFA3 orthologs across fungal species could indicate whether its function is universally important or has evolved specialized roles in pathogenic fungi like C. albicans.

Comparative genomic and proteomic analyses could examine:

  • Sequence conservation of the catalytic DHHC domain across species

  • Conservation of vacuolar localization signals

  • Presence of additional domains that might confer species-specific functions

  • Correlation between PFA3 sequence divergence and species' ecological niches

Understanding the evolutionary trajectory of PFA3 could provide insights into its fundamental biological importance and potentially reveal why it has been maintained throughout fungal evolution. This knowledge could also help predict which aspects of PFA3 function are essential and therefore represent the most promising targets for antifungal development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.