Recombinant Candida albicans Palmitoyltransferase PFA4 (PFA4)

Shipped with Ice Packs
In Stock

Description

Role in Fungal Virulence and Pathogenesis

PFA4 is indispensable for Candida albicans virulence. Key findings include:

Ras1 Palmitoylation and Thermotolerance

  • Deletion of PFA4 reduces Ras1 palmitoylation by 50–59%, impairing PM localization and high-temperature growth (37°C) .

  • Pfa4Δ mutants exhibit attenuated virulence in murine models, with 100% survival of infected mice vs. lethal wild-type infections .

Stress Response and Morphogenesis

  • PFA4-deficient strains show hypersensitivity to oxidative/nitrosative stress and cell wall stressors (e.g., Congo Red) .

  • Impaired hyphal morphogenesis under low-phosphate conditions, critical for tissue invasion .

Host-Pathogen Interactions

  • Altered PM localization of virulence factors reduces macrophage evasion and survival in RAW 264.7 macrophages .

  • PFA4 indirectly modulates adhesion to intestinal mucosa, though its role in commensalism remains secondary .

Recombinant PFA4 Applications and Availability

Recombinant PFA4 is commercially produced for functional studies.

Production and Species Specificity

Host SystemApplications
Escherichia coliStructural studies, enzyme kinetics
Saccharomyces cerevisiaeFunctional complementation assays
Pichia pastorisHigh-yield expression for biochemical assays

Available recombinant variants include:

  • His-tagged PFA4 (Creative BioMart)

  • GFP/RFP fusion constructs for localization studies

Key Substrates and Interaction Partners

SubstrateFunctionInteraction Score
Ras1GTPase regulating morphogenesis, thermotolerance0.783 (Akr1 co-regulation)
Vac8Vacuolar inheritance, membrane fusion0.672
SNARE proteinsVesicle trafficking, membrane fusion0.608 (Swf1 synergy)

Phenotypic Impact of PFA4 Deletion

PhenotypePfa4Δ vs. Wild Type
Growth at 37°CSeverely impaired (≤30% viability)
Virulence in Mice0% mortality (vs. 100% wild type)
Hyphal FormationReduced filamentation on Spider medium

Evolutionary and Therapeutic Insights

  • Functional Redundancy: Partial compensation by Pfa3/Pfa5 in Ras1 palmitoylation, yet Pfa4Δ retains severe defects .

  • Antifungal Targets: PFA4’s essential role in Ras1 activation positions it as a candidate for inhibitor development .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
PFA4; CAALFM_C701480WA; CaJ7.0163; CaO19.13934; CaO19.6581; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
PFA4
Target Protein Sequence
MAVQLKWPILGVIIPCIIIFSLSYGSHYFILRHHLTMKQQLIYEFYVTMIWISYLLAIYT NPGRVPKNYKPSLASSTRIEQTEDDSDGLGLESREDETLIREEPISGDRCEWIRYCKKCN NYKPPRSHHCKICQQCVLQMDHHCPWTLNCVGNNNLPHFMRFLGWIIWGTGYLMIQLIKL IINYYENSNMPHYLFNKTELVAIIAITPLNFFVFASILVLFIRCLINICKGMTQIEIWEW ERLELQWSSKRLWRLIRFNYGRLHKGKPFPELNTWTNTTNNVNYNDNDDDGDEDVELINL ATNNNEDSTIVPQNFTIDDLIFPYNLGIWKNLVNALGYPYMWLIPFGKPKSNGYQPQISQ DYKQDDQLNLPWPPDGIRQKEIEINVLQQQGYQRDREEEDEEELRSIRNYQELRRRLDPR LNVQRSDFINDMGEGLTDFGVDEDSD
Uniprot No.

Target Background

Function
PFA4, a palmitoyltransferase from Candida albicans, mediates the reversible addition of palmitate to target proteins. This process regulates their membrane association and biological function.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Palmitoyltransferase PFA4 and what is its function in Candida albicans?

Palmitoyltransferase PFA4 (PFA4) is a protein S-acyltransferase (PAT) that catalyzes the reversible attachment of palmitic acid moieties to proteins through thioesterification of cysteine side chain groups. This post-translational modification, known as S-palmitoylation, facilitates the association of target proteins with membranes. In Candida albicans, PFA4 plays critical roles in cell morphology, stress tolerance, and virulence by modifying proteins involved in cell wall synthesis, signal transduction, and membrane trafficking .

To study PFA4 function, researchers typically use deletion mutants (pfa4Δ) and observe resulting phenotypic changes. Comparisons between wild-type and mutant strains reveal that PFA4 activity affects membrane protein localization, particularly of proteins involved in pathogenicity, such as Ras1 in related fungal species .

How does recombinant PFA4 protein differ from native PFA4 in C. albicans?

Recombinant PFA4 is typically produced in heterologous expression systems such as E. coli, where the full-length protein (446 amino acids) is expressed with fusion tags (commonly His-tags) to facilitate purification . The recombinant version contains the complete amino acid sequence of native PFA4 but may exhibit differences in post-translational modifications, folding patterns, and enzymatic activity due to the expression system.

To assess functional equivalence, researchers should conduct activity assays comparing recombinant and native PFA4. For accurate structural and functional studies, it's essential to verify that the recombinant protein maintains the critical DHHC domain integrity and proper folding of other conserved motifs like the PaCCT (Palmitoyltransferase Conserved C-Terminus) .

What are the optimal storage and handling conditions for recombinant PFA4 protein?

Recombinant PFA4 should be stored according to the following protocol:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C to -80°CAliquoting is necessary to avoid repeated freeze-thaw cycles
Working stock4°CStable for up to one week
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability
Reconstitution0.1-1.0 mg/mL in deionized sterile waterAdd 5-50% glycerol (final concentration) for long-term storage

Before opening, briefly centrifuge the vial to bring contents to the bottom. After reconstitution, prepare small working aliquots to minimize freeze-thaw cycles, which can significantly reduce enzymatic activity .

How can palmitoylation activity of recombinant PFA4 be measured in vitro?

Measuring PFA4 palmitoylation activity requires a multi-step approach:

  • Autopalmitoylation assay: Since PATs like PFA4 undergo a two-step transfer mechanism, first measure autopalmitoylation using fluorescent palmitoyl-CoA analogs or radiolabeled palmitoyl-CoA .

  • Substrate palmitoylation assay: After confirming autopalmitoylation, assess transfer to known substrates like Ras1 using:

    • Click chemistry with alkyne-labeled palmitic acid

    • Acyl-biotinyl exchange (ABE) assay

    • Metabolic labeling with [3H]-palmitate

  • Kinetic analysis: Determine enzyme parameters (Km, Vmax) by varying substrate concentrations and measuring initial reaction rates.

For accurate results, control experiments should include:

  • Catalytically inactive PFA4 (DHHC mutant) as a negative control

  • Known active PAT as a positive control

  • No-enzyme controls to account for non-enzymatic palmitoylation

How does the substrate specificity of PFA4 compare to other fungal protein S-acyltransferases?

PFA4 demonstrates both unique and overlapping substrate specificity compared to other fungal PATs. Research indicates:

PATUnique SubstratesShared SubstratesDefining Features
PFA4Cell wall synthesis proteins, specific membrane trafficking proteinsRas family proteinsRetains partial activity despite DHHC mutations
Other fungal PATsOrganism-specific signaling proteinsConserved small GTPasesTypically inactive with DHHC mutations

The partial preservation of PFA4 activity despite mutations in the DHHC motif distinguishes it from most other PATs, suggesting alternative catalytic mechanisms or secondary acylation sites . This property makes PFA4 particularly interesting for structure-function studies.

To investigate substrate specificity experimentally, researchers should perform comparative palmitoylome analysis using bioorthogonal techniques with different PAT deletion strains, followed by mass spectrometry identification of differentially palmitoylated proteins .

What are the methodological challenges in studying the interaction between palmitoylation and virulence in C. albicans?

Studying the relationship between PFA4-mediated palmitoylation and virulence presents several methodological challenges:

  • Target identification complexity: Distinguishing direct from indirect PFA4 substrates requires sophisticated proteomics approaches:

    • Acyl-biotin exchange (ABE) combined with stable isotope labeling

    • Metabolic labeling with clickable palmitate analogs

    • Comparison of palmitoylomes between wild-type and pfa4Δ strains

  • Phenotype attribution: Since PFA4 has multiple substrates, connecting specific palmitoylation events to virulence phenotypes requires:

    • Site-directed mutagenesis of palmitoylation sites in individual proteins

    • Generation of substrate-specific palmitoylation-deficient mutants

    • Complementation studies with mutant versions of PFA4

  • Model system limitations: Host-pathogen interaction studies should consider:

    • Differences between in vitro and in vivo conditions affecting palmitoylation

    • Variable expression levels of PFA4 during different infection stages

    • Host factors that might influence palmitoylation dynamics

To address these challenges, integrative approaches combining transcriptomics, proteomics, and in vivo infection models are recommended.

What expression systems are most effective for producing functional recombinant PFA4?

The choice of expression system significantly impacts the yield and functionality of recombinant PFA4:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, cost-effective, established protocolsMembrane protein folding issues, lack of eukaryotic PTMsFusion with solubility tags, reduced expression temperature (16-20°C), specialized strains (C41/C43)
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, membrane protein machineryLower yields than E. coliCodon optimization, inducible promoters, protease-deficient strains
Insect cells (Sf9, Hi5)Complex eukaryotic PTMs, membrane protein foldingHigher cost, technical complexityBaculovirus optimization, secretion signal addition

To optimize expression, consider:

  • Using truncated constructs that retain the catalytic DHHC domain

  • Incorporating detergents during purification to maintain membrane protein stability

  • Verifying activity of the purified protein through autopalmitoylation assays

How can researchers troubleshoot issues with recombinant PFA4 activity?

When recombinant PFA4 exhibits suboptimal enzymatic activity, consider the following troubleshooting approaches:

  • Protein integrity assessment:

    • Verify complete sequence including the critical DHHC domain and PaCCT motif

    • Confirm proper folding through circular dichroism or limited proteolysis

    • Assess aggregation state via size-exclusion chromatography

  • Cofactor requirements:

    • Ensure sufficient Zn2+ availability (coordinate with DHHC domain)

    • Test different palmitoyl-CoA concentrations (0.1-20 μM range)

    • Evaluate buffer components affecting membrane protein stability

  • Assay optimization:

    • Adjust pH (typically optimal between 6.8-7.5)

    • Test detergent types and concentrations

    • Include reducing agents (DTT or TCEP) to prevent oxidation of catalytic cysteines

If activity remains low, consider reconstituting PFA4 into liposomes or nanodiscs to provide a more native-like membrane environment, which often enhances the activity of membrane-associated enzymes like PATs .

How does PFA4 deletion affect host-pathogen interactions in fungal infection models?

PFA4 deletion causes profound alterations in host-pathogen interactions based on studies in Cryptococcus neoformans, a related fungal pathogen:

  • Phagocyte engagement: The pfa4Δ mutant exhibits defects in adherence to and phagocytosis by host monocytes, suggesting altered cell surface properties that affect recognition patterns .

  • Intracellular survival: Loss of PFA4 compromises the ability of fungal cells to survive within phagocytes through mechanisms including:

    • Impaired stress tolerance to oxidative conditions

    • Altered cell wall composition affecting immune recognition

    • Disrupted membrane trafficking essential for countering host defenses

  • Virulence attenuation: In animal models, PFA4 deletion results in:

    • Reduced fungal burden in infected tissues

    • Impaired dissemination from primary infection sites

    • Prolonged host survival compared to wild-type infections

These findings indicate that PFA4 influences multiple aspects of fungal pathogenicity through its diverse substrate range. For C. albicans research, similar phenotypes would be expected, though specific patterns may differ due to species-specific pathogenesis mechanisms.

What methodological approaches can identify novel PFA4 substrates relevant to pathogenesis?

To identify pathogenesis-relevant PFA4 substrates, researchers should implement a multi-faceted approach:

  • Global palmitoylome analysis:

    • Metabolic labeling with alkyne-palmitate followed by click chemistry and MS/MS

    • Acyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC) comparing wild-type and pfa4Δ strains

    • Quantitative proteomics using SILAC or TMT labeling to identify differentially palmitoylated proteins

  • Candidate-based validation:

    • Site-directed mutagenesis of predicted palmitoylation sites (CSS-Palm algorithm)

    • In vitro palmitoylation assays with purified recombinant PFA4 and candidate substrates

    • Localization studies using fluorescent protein fusions to assess membrane association changes

  • Functional relevance confirmation:

    • Phenotypic analysis of palmitoylation-deficient substrate mutants

    • Complementation studies in pfa4Δ background

    • Host interaction assays with substrate mutants

A comprehensive approach for C. albicans would include correlation of identified substrates with transcriptome data during infection stages to prioritize pathogenically relevant targets.

How does the DHHC motif contribute to the catalytic mechanism of PFA4?

The DHHC (Asp-His-His-Cys) motif is central to PAT activity, but research reveals unique aspects of PFA4's catalytic mechanism:

  • Canonical DHHC function: In most PATs, the cysteine residue within the DHHC motif:

    • Forms a thioester intermediate with the palmitoyl group during autopalmitoylation

    • Acts as the primary site for acyl transfer to substrate proteins

    • Is absolutely required for enzymatic activity

  • PFA4-specific variations: Unlike typical PATs, PFA4 from yeast demonstrates:

    • Partial retention of activity despite DHHC cysteine mutations

    • Possible secondary autoacylation sites beyond the DHHC domain

    • Potentially alternative catalytic mechanisms involving other conserved residues

  • Structural contributions: Beyond direct catalysis, the DHHC domain:

    • Coordinates zinc ions critical for structural integrity

    • Positions substrate proteins for optimal acyl transfer

    • Interacts with the palmitoyl-CoA acyl donor

To investigate these mechanisms experimentally:

  • Generate point mutations within and surrounding the DHHC motif

  • Perform kinetic studies comparing wild-type and mutant proteins

  • Use chemical crosslinking to capture enzyme-substrate intermediates

What techniques can resolve the structure-function relationship of PFA4's transmembrane domains?

Understanding PFA4's transmembrane domains requires specialized approaches:

  • Structural determination methods:

    • Cryo-electron microscopy of reconstituted PFA4 in nanodiscs

    • X-ray crystallography with lipidic cubic phase crystallization

    • NMR studies of individually expressed transmembrane segments

    • Molecular dynamics simulations based on homology models

  • Functional mapping techniques:

    • Cysteine accessibility scanning to identify membrane-embedded regions

    • Glycosylation mapping to determine membrane topology

    • Truncation and chimera analysis to identify domains critical for substrate recognition

    • Site-directed mutagenesis of conserved residues within transmembrane helices

  • Integrative approaches:

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Cross-linking mass spectrometry to capture substrate interaction sites

    • In silico substrate docking using structural models

These techniques can reveal how PFA4's transmembrane domains contribute to substrate recognition, membrane positioning, and the creation of a catalytic pocket suitable for acyltransferase activity .

How is PFA4 activity regulated during different stages of fungal pathogenesis?

PFA4 activity regulation during fungal pathogenesis involves multiple layers:

  • Transcriptional regulation:

    • Expression changes during morphological transitions (yeast to hyphal forms)

    • Stress-responsive elements in the promoter region responding to host conditions

    • Possible regulation by virulence-associated transcription factors

  • Post-translational modifications:

    • Potential phosphorylation affecting enzyme activity or localization

    • Self-palmitoylation as a regulatory mechanism

    • Protein-protein interactions modulating substrate access

  • Spatial regulation:

    • Compartmentalization within specific membrane microdomains

    • Trafficking between organelles during different infection stages

    • Co-localization with specific substrate pools

To study these regulatory mechanisms, researchers should:

  • Monitor PFA4 expression using reporter constructs during infection

  • Generate phosphomimetic and phosphodeficient mutants to assess PTM effects

  • Track subcellular localization changes during host cell interaction

Understanding these regulatory mechanisms could reveal potential intervention points for antifungal development targeting this critical virulence factor.

What is the interplay between palmitoylation by PFA4 and depalmitoylation enzymes in C. albicans?

The dynamic balance between PFA4-mediated palmitoylation and depalmitoylation by thioesterases represents a critical regulatory system:

  • Depalmitoylation enzymes: The C. albicans genome contains homologs of:

    • APT1 and APT2 (acyl-protein thioesterases)

    • APTL1/LYPLAL1-like proteins

    • Potentially other uncharacterized depalmitoylating enzymes

  • Regulatory dynamics:

    • Subcellular localization of both enzyme classes affects substrate accessibility

    • Depalmitoylases themselves undergo palmitoylation, creating feedback loops

    • Differential expression patterns during infection stages

  • Functional consequences:

    • Cycles of palmitoylation/depalmitoylation control protein shuttling between membranes

    • The rate of these cycles affects signaling duration and intensity

    • Disruption of either process alters virulence factor localization and function

To investigate this interplay experimentally:

  • Generate double mutants lacking both PFA4 and depalmitoylating enzymes

  • Use pulse-chase experiments with clickable palmitate analogs to measure turnover rates

  • Apply depalmitoylation inhibitors (e.g., palmostatin B, HDFP) to assess pathway interdependence

This dynamic system represents an underexplored aspect of fungal pathogenesis with potential implications for therapeutic targeting.

How can recombinant PFA4 be used to screen for novel antifungal inhibitors?

Recombinant PFA4 offers a valuable platform for antifungal drug discovery through several screening approaches:

  • In vitro enzymatic assays:

    • Fluorescence-based high-throughput screening measuring inhibition of autopalmitoylation

    • Transfer assays using purified substrates and detection of palmitoylation inhibition

    • Competitive binding assays with palmitoyl-CoA analogs

  • Structure-based drug design:

    • Virtual screening against the PFA4 catalytic pocket

    • Fragment-based approaches targeting the DHHC domain

    • Covalent inhibitor design targeting the catalytic cysteine

  • Cellular validation systems:

    • Yeast-based assays with PFA4-dependent reporter systems

    • C. albicans growth inhibition correlation with PFA4 inhibition

    • Phenotypic rescue experiments comparing inhibitor effects to pfa4Δ phenotypes

The ideal screening cascade would progress from:

  • Primary biochemical screens with recombinant PFA4

  • Secondary cellular assays in fungi

  • Tertiary assays in host-pathogen models

  • Selectivity profiling against human PATs to ensure specificity

Development of PFA4 inhibitors could provide novel antifungals with mechanisms distinct from current clinical options.

What are the methodological considerations for validating PFA4 as an antifungal target in vivo?

Validating PFA4 as an antifungal target requires rigorous in vivo assessment:

  • Target validation approaches:

    • Conditional mutants (tetracycline-regulated) to confirm essentiality in vivo

    • Complementation with inhibitor-resistant PFA4 mutants to confirm mechanism of action

    • Comparison of inhibitor effects with genetic deletion phenotypes across infection models

  • In vivo efficacy models:

    • Murine disseminated candidiasis model measuring fungal burden and survival

    • Ex vivo human tissue models assessing hyphal invasion inhibition

    • Galleria mellonella infection model for rapid screening

  • Pharmacological considerations:

    • PK/PD studies ensuring inhibitor reaches infection sites

    • Determination of minimum effective concentrations in tissue

    • Assessment of resistance development through serial passage

  • Toxicity evaluation:

    • Selectivity profiling against human PATs (DHHC proteins)

    • Assessment of off-target effects on host palmitoylation

    • Monitoring of host immune function with PFA4 inhibitor treatment

The strongest validation would demonstrate that chemical inhibition of PFA4 recapitulates the virulence attenuation observed in genetic deletion studies while minimizing effects on host proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.