Recombinant Candida albicans pH-response regulator protein palH/RIM21 (RIM21)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant RIM21 is a full-length, 529-amino-acid protein (UniProt ID: Q59YK4) expressed in E. coli with an N-terminal His tag . Key specifications include:

PropertyDetails
SourceCandida albicans
Expression SystemEscherichia coli
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water, with optional glycerol for stability

This recombinant form retains native functionality, enabling studies on pH sensing and signal transduction .

Domain Architecture

RIM21 is a polytopic plasma membrane protein with:

  • N-terminal extracellular region: Contains an unconventional N-glycosylation site (Asn-27) critical for membrane microdomain localization and protein turnover .

  • C-terminal cytosolic region: Essential for sensing plasma membrane lipid asymmetry and depolarization .

Post-Translational Modifications

  • N-glycosylation: Modulates residence in lipid-rich microdomains but is dispensable for pH-sensing activity .

  • Proteolytic processing: Required for downstream activation of transcription factor Rim101 .

Functional Role in pH Signaling

RIM21 is the primary sensor in the conserved Rim101 pathway, which regulates fungal adaptation to alkaline environments .

Signaling Mechanism

  1. pH Sensing: Under alkaline conditions, RIM21 forms a complex with Rim9 and Dfg16 to detect extracellular pH changes .

  2. Signal Transduction:

    • Induces endocytosis of the sensor complex.

    • Recruits ESCRT machinery and protease Rim13 to cleave Rim101, activating its transcriptional function .

  3. Gene Regulation: Active Rim101 induces alkaline-responsive genes (e.g., PHR1) and represses acidic-responsive genes (e.g., PHR2) .

Antifungal Tolerance

Genetic disruption of RIM21 enhances susceptibility to azoles (e.g., fluconazole) and echinocandins (e.g., micafungin) . Key mechanisms include:

  • Downregulation of HSP90: Reduces chaperone-mediated stress adaptation .

  • Altered sphingolipid biosynthesis: Via Rim-dependent expression of IPT1 .

Interaction Network

RIM21 collaborates with multiple proteins in the Rim pathway :

Partner ProteinFunctionInteraction Score
Rim9Stabilizes RIM21 membrane localization0.981
Rim8Arrestin facilitating signal transduction0.974
Rim13Protease activating Rim1010.936
Rim20Scaffold for ESCRT-III recruitment0.935
Rim101Transcription factor0.934

Antifungal Development

  • Target Identification: Rim pathway inhibition synergizes with azoles/echinocandins, reducing drug tolerance .

  • HSP90 Modulation: Rim101 regulates HSP90 expression, suggesting combinatorial therapies targeting Hsp90 and Rim signaling .

Key Research Findings

  1. Sensor Specificity: RIM21 detects both pH changes and plasma membrane depolarization, unlike auxiliary proteins Rim9/Dfg16 .

  2. Transcriptional Control: RNA-Seq revealed 346 Rim101-dependent genes, including HSP90 and IPT1, linking pH adaptation to stress tolerance .

  3. Biochemical Stability: N-glycosylation extends RIM21’s half-life but does not alter its sensor activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
RIM21; CAALFM_C501950CA; CaO19.10686; CaO19.3176; pH-response regulator protein palH/RIM21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-529
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
RIM21
Target Protein Sequence
MYWKNAWWVGTVYSSCEPIELPEGMLISKQYETYPITTVSKAIYKQMCYRNCIPVLNTNV GFVIDTFAKPLPIVSQSWREFTKDSLRGSFAYSVVSIIYAIAVSAVIIWFLTIFVLTNYT IKPSWLLKTSTILSTVYILVVVIKSILILHGQQRDGYLHGAKLLSELNDYNPIQIIDLIV VLLLQINQVQIIMRIFQRQKDKRMALLIGIVATLASQVIWAIAQFYTPADANEASDILPA FIYLVRIAMALCYAAIITVFFISKIQIILANKKIWLLTLLTFILIYSPVAFFVADVSNAF VYELSEIFSVVNYVIGVVIPWEWCNKFNLIMKAKEKEGVLGRRFYEDELYELDRFELFVE EQMPEDEDNGDTHSDSPGNELNGGAHHNSQEQSDRLIGSNSPTNKPHNGNNTDPTSRFRQ LLTNTKDAFLTLTDNIIAAGFAIPRSVSVSTQSLTGRYRNNSTARTEYTKEVVPDFSPEM FLQPEGSSHITETLSEQNAAPSTTNSNHRRRNVYVYSRKEVILDVSSDE
Uniprot No.

Target Background

Function
Essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline pH.
Database Links
Protein Families
PalH/RIM21 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is RIM21 and what is its primary function in Candida albicans?

RIM21 (also known as palH in some fungal species) is a transmembrane protein that functions as the primary pH sensor in the Rim pathway of fungi. In C. albicans, RIM21 contains seven transmembrane domains and localizes to the plasma membrane in a patchy distribution. Its principal function is to detect environmental pH changes, particularly alkaline conditions, and initiate signal transduction through the Rim pathway. This pathway ultimately leads to the activation of the Rim101 transcription factor, which regulates genes involved in multiple cellular processes including growth, iron metabolism, cell wall structure, yeast-to-hypha transition, adhesion, and biofilm formation . The pH-sensing capability of RIM21 is critical for C. albicans to adapt to varying pH environments encountered during host colonization and infection.

How does the Rim pathway function in pH sensing and signal transduction?

In the Rim pathway, external pH is sensed by a complex of two transmembrane proteins, Rim9 and Rim21/Dfg16, and the arrestin-like protein Rim8. Under neutral-alkaline conditions, Rim8 becomes hyperphosphorylated, leading to endocytosis of this membrane complex and recruitment of the endosomal sorting complexes required for transport (ESCRT) I, II, and III. Two other Rim proteins, Rim20 and the signaling protease Rim13, are then recruited, leading to cleavage of the C-terminal inhibitory domain of Rim101, the final transcription factor of the Rim pathway . Evidence from S. cerevisiae studies indicates that Rim21 is the actual pH sensor protein, with Dfg16 and Rim9 playing auxiliary roles by maintaining appropriate levels of Rim21 and assisting in its plasma membrane localization . Upon activation, cleaved Rim101 migrates to the nucleus where it regulates target genes involved in pH adaptation and other cellular processes.

What experimental evidence confirms RIM21 as the primary pH sensor rather than other Rim proteins?

Definitive evidence establishing RIM21 as the primary pH sensor comes from studies using transient protein degradation systems. In S. cerevisiae, researchers demonstrated that the transient degradation of Rim21 completely suppressed the Rim101 pathway activation, whereas degradation of Dfg16 or Rim9 did not have the same effect . Additionally, RIM21 was found to mediate Rim101 pathway activation even without external alkalization when cells were treated with protonophores or depleted of phosphatidylserine in the inner leaflet of the plasma membrane - both conditions that cause plasma membrane depolarization similar to external alkalization . This finding suggests that RIM21 may directly sense membrane potential changes associated with pH shifts rather than pH itself. Furthermore, the mutual dependence of Rim21, Dfg16, and Rim9 for proper localization and stability, with particular sensitivity of Rim21 levels to the absence of the other components, supports the model where Rim21 is the sensor while Dfg16 and Rim9 serve supporting roles .

What are the optimal expression systems and purification strategies for recombinant C. albicans RIM21?

For optimal expression and purification of recombinant C. albicans RIM21, researchers should consider the following methodological approach:

Expression SystemAdvantagesConsiderationsRecommended Tags
P. pastorisEukaryotic processing, high yieldLonger expression timeC-terminal His6
S. cerevisiaeNative-like environmentLower yieldsHA or FLAG
Mammalian cellsComplex glycosylationExpensive, complexFc fusion
E. coliRapid, economicalLimited for full protein, suitable for domainsMBP, SUMO

The purification protocol should include: (1) Membrane extraction using mild detergents like DDM or LMNG; (2) Affinity chromatography using the fusion tag; (3) Size exclusion chromatography for final purification; and (4) Quality assessment via Western blotting and thermal shift assays. For structural studies, consider reconstitution into nanodiscs or amphipols to maintain native-like membrane environment. If purifying the full-length transmembrane protein proves challenging, expressing individual domains (particularly the cytoplasmic regions) may provide valuable structural and functional insights while being more amenable to purification.

How can researchers effectively monitor RIM21 localization and dynamics in response to pH changes?

To effectively monitor RIM21 localization and dynamics in response to pH changes, researchers should employ a multi-faceted approach:

  • Fluorescent Protein Tagging: Generate C. albicans strains expressing RIM21-GFP or RIM21-mCherry fusion proteins under the native promoter. Ensure the tag doesn't interfere with function through complementation studies in rim21Δ backgrounds.

  • Live Cell Imaging Systems: Utilize microfluidic chambers that allow real-time pH adjustments while imaging. This enables the observation of RIM21 redistribution upon alkalization, which typically presents as a transition from patchy plasma membrane localization to internalized puncta .

  • Co-localization Studies: Simultaneously track RIM21 with markers for the plasma membrane, endosomes, and vacuoles to characterize the internalization pathway. This can be achieved using different colored fluorescent proteins or specific dyes.

  • Advanced Microscopy Techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure RIM21 mobility in the membrane

    • TIRF (Total Internal Reflection Fluorescence) microscopy for better visualization of membrane-associated RIM21

    • Super-resolution techniques like STORM or PALM for detailed localization patterns

  • Quantitative Analysis: Develop image analysis pipelines to quantify the ratio of membrane to cytoplasmic signal over time after pH changes, the size and number of RIM21 patches, and colocalization coefficients with other pathway components.

Previous studies have shown that RIM21 and other sensor complex proteins are internalized and degraded upon external alkalization , making these techniques particularly valuable for characterizing this dynamic process.

What are the most reliable methods for assessing RIM21-dependent activation of the Rim pathway?

For reliable assessment of RIM21-dependent activation of the Rim pathway, researchers should implement a multi-level analysis approach:

  • Rim101 Processing Assay: The most direct measure of pathway activation is monitoring Rim101 processing by Western blotting, using antibodies against tagged or native Rim101. The processed (active) form appears as a faster-migrating band compared to the full-length protein. This assay should be performed in wild-type, rim21Δ, and complemented strains to confirm RIM21 dependence.

  • Transcriptional Reporter Systems:

    • Luciferase or GFP reporters driven by Rim101-regulated promoters (e.g., PHR1, which is induced at alkaline pH)

    • qRT-PCR analysis of known Rim101 target genes, including PHR1 (induced) and PHR2 (repressed)

  • Growth Phenotype Assays:

    • Spot dilution assays on media with varying pH (5.5 vs. 8.0)

    • Growth curves in liquid media at different pH values

    • Lithium sensitivity tests (rim mutants typically show increased sensitivity)

  • Microscopy-Based Assays:

    • Visualizing nuclear translocation of fluorescently-tagged Rim101 following pH shift

    • Co-localization of Rim pathway components during activation

  • Proteomic Approaches:

    • Phosphoproteomic analysis to detect Rim8 hyperphosphorylation, an early event in pathway activation

    • Temporal analysis of protein complexes forming during pH response

When implementing these assays, it's critical to include appropriate controls, including rim101Δ strains (negative control for downstream effects) and strains with constitutively active Rim101 (positive control independent of upstream signaling).

What is the molecular mechanism by which RIM21 senses changes in ambient pH?

The molecular mechanism of RIM21 pH sensing remains incompletely understood, but several lines of evidence suggest a model where RIM21 may sense plasma membrane properties rather than directly detecting proton concentration:

  • Membrane Depolarization Sensing: Studies in S. cerevisiae demonstrate that RIM21 can activate the Rim101 pathway in response to plasma membrane depolarization even without external alkalization. When cells were treated with protonophores or depleted of phosphatidylserine in the inner leaflet of the plasma membrane, both of which cause membrane depolarization similar to external alkalization, the Rim101 pathway was activated in a RIM21-dependent manner . This strongly suggests that RIM21 may function primarily as a membrane potential sensor.

  • Lipid Asymmetry Detection: The Rim101 pathway has been shown to sense altered lipid asymmetry in the plasma membrane . Since external alkalization can affect lipid organization in the membrane, RIM21 might detect these structural changes rather than pH itself.

  • Conformational Changes: pH-induced alterations in membrane properties likely trigger conformational changes in RIM21's transmembrane domains, which are then transduced to initiate signaling. This could involve exposure or rearrangement of binding sites for downstream effectors like Rim8.

  • Cooperative Sensing: While RIM21 appears to be the primary sensor, its function depends on auxiliary proteins Dfg16 and Rim9, suggesting a complex sensing apparatus that responds collectively to membrane perturbations caused by pH changes.

This membrane-focused sensing mechanism would allow fungi to respond to pH changes without exposing sensitive protein domains directly to potentially damaging alkaline environments.

How do post-translational modifications regulate RIM21 activity and stability?

Post-translational modifications play crucial roles in regulating RIM21 activity and stability, creating a complex regulatory network:

  • Phosphorylation: While direct evidence for RIM21 phosphorylation is limited, the Rim pathway involves phosphorylation events, particularly of Rim8, which becomes hyperphosphorylated upon alkaline pH stimulation . RIM21 likely undergoes phosphorylation that affects its conformation or interactions with other proteins.

  • Ubiquitination: Upon external alkalization, RIM21 and other sensor complex proteins are internalized and degraded . This process almost certainly involves ubiquitination, marking RIM21 for endocytosis and subsequent degradation. The ESCRT machinery, which is recruited to the Rim pathway upon activation, typically recognizes ubiquitinated cargo, supporting this model.

  • Protein Stability Regulation: The cellular level of RIM21 is significantly decreased in dfg16Δ and rim9Δ cells , indicating that these proteins help maintain RIM21 stability. In C. neoformans, the Rra1 sensor (functionally analogous to RIM21) interacts with a nucleosome assembly protein Nap1 that promotes its stability , suggesting similar stabilizing interactions may exist for RIM21.

  • Endocytosis and Degradation: Dynamic regulation through internalization appears to be a key control mechanism, as RIM21 undergoes endocytosis and degradation following alkaline pH exposure . This likely serves as a feedback mechanism to attenuate signaling after pathway activation.

These regulatory mechanisms ensure precise control of pH sensing, allowing appropriate activation of the pathway while preventing excessive or inappropriate signaling that could be detrimental to cellular function.

How does the RIM21-dependent signaling pathway differ between C. albicans and other fungal species?

The RIM21-dependent signaling pathway shows significant evolutionary divergence across fungal species, reflecting adaptation to different ecological niches:

Fungal SpeciespH SensorPathway StructureKey DifferencesEvolutionary Implications
C. albicansRIM21/palHCanonical Rim pathway with Rim8, Rim13, Rim20, Rim101Regulates virulence traits, hyphal transitionAdapted for host colonization
S. cerevisiaeRim21Similar to C. albicansLacks virulence connections, focuses on pH adaptationAdapted for fermentation environments
A. nidulansPalHPal pathway, homologous to RimPalI assists PalH localizationConserved ascomycete mechanism
C. neoformansRra1 (not RIM21)Divergent from ascomycete Rim pathwayRra1 interacts with Nap1 for stabilityIndependent evolution in basidiomycetes

In stark contrast, basidiomycete fungi like C. neoformans lack true RIM21 homologs but instead use a protein called Rra1 as their pH sensor . Rra1 does not strongly interact with immediate downstream Rim pathway components as RIM21 does in ascomycetes. Instead, Rra1 interacts with a nucleosome assembly protein (Nap1) that promotes Rra1 stability .

These differences highlight the evolutionary plasticity of pH sensing mechanisms across fungal lineages, with C. albicans maintaining the canonical ascomycete pathway while employing species-specific adaptations related to its pathogenic lifestyle.

How does RIM21 contribute to antifungal drug resistance in C. albicans?

RIM21 contributes to antifungal drug resistance in C. albicans through several interconnected mechanisms as the primary sensor initiating the Rim pathway:

  • Regulation of Stress Response Networks: By activating Rim101, RIM21 signaling upregulates stress response genes that help C. albicans survive drug exposure. Notably, the Rim pathway regulates HSP90 expression, a major molecular chaperone known to play central roles in antifungal resistance . Rim mutants are hypersensitive to pharmacological inhibition of Hsp90, suggesting that RIM21-initiated signaling helps maintain Hsp90-mediated stress responses.

  • Cell Wall Remodeling: The Rim pathway controls the expression of numerous cell wall-related genes, including PHR1, SKN1, and KRE6 . These alterations in cell wall composition can affect drug penetration and efficacy, particularly for echinocandins that target cell wall synthesis.

  • Membrane Composition: RIM21 signaling regulates IPT1, a gene involved in sphingolipid biosynthesis . Sphingolipids are critical membrane components that influence membrane fluidity and permeability, potentially affecting drug uptake and efflux.

  • Morphological Transitions: By regulating hyphal morphogenesis, the RIM21-initiated pathway affects C. albicans' ability to form biofilms, which provide a protective environment against antifungals.

Experimental evidence confirms this role, as mutations in RIM pathway components lead to hypersensitivity to both azoles (fluconazole, voriconazole, posaconazole) and echinocandins (micafungin, anidulafungin) . All rim mutants tested showed increased susceptibility to these antifungals, demonstrating the pathway's importance in drug tolerance.

What therapeutic strategies could target RIM21 to enhance antifungal treatment efficacy?

Targeting RIM21 represents a promising approach to enhance antifungal treatment efficacy through several potential therapeutic strategies:

  • Direct RIM21 Inhibitors:

    • Small molecules targeting the transmembrane domains or sensor regions

    • Peptidomimetics that disrupt critical protein-protein interactions between RIM21 and other Rim pathway components

    • Allosteric inhibitors that lock RIM21 in an inactive conformation

  • Combination Therapy Approaches:

    • RIM21/Rim pathway inhibitors combined with conventional antifungals

    • Particular synergy expected with azoles and echinocandins, given the hypersensitivity of rim mutants to these drugs

    • Sequential therapy that first inhibits the Rim pathway before administering standard antifungals

  • Indirect Targeting Strategies:

    • Compounds that interfere with auxiliary proteins (Dfg16, Rim9) required for RIM21 stability and function

    • Agents that enhance RIM21 degradation or prevent its proper localization

    • Drugs that target downstream components like Rim8 or prevent Rim101 processing

  • Dual-Target Approaches:

    • Simultaneous inhibition of RIM21 and Hsp90, exploiting the relationship between the Rim pathway and Hsp90

    • Combining RIM21 inhibition with cell wall-targeting agents to exploit changes in cell wall composition

The experimental evidence that rim mutants are hypersensitive to multiple classes of antifungals suggests that RIM21 inhibition could broadly enhance the efficacy of existing antifungal drugs, potentially allowing lower doses and reducing the development of resistance. This approach is particularly attractive as it targets a fungal-specific pathway with no human homolog, potentially reducing side effects.

How is RIM21 function connected to C. albicans virulence in different host microenvironments?

RIM21 function is intricately connected to C. albicans virulence through its ability to sense and respond to the varying pH environments encountered during infection:

  • Adaptation to Host Niches: C. albicans encounters diverse pH environments during infection—from the acidic vaginal mucosa (pH ~4) to the neutral/slightly alkaline bloodstream (pH ~7.4). RIM21 enables sensing of these different environments, triggering appropriate adaptive responses through the Rim pathway .

  • Morphological Plasticity: The RIM21-initiated Rim pathway regulates the yeast-to-hypha transition, which is critical for tissue invasion . Alkaline pH is a potent inducer of hyphal formation, and this response is partially mediated through RIM21 sensing and Rim101 activation. The ability to switch between yeast and hyphal forms is considered one of the most important virulence traits of C. albicans.

  • Biofilm Formation: The Rim pathway influences the expression of genes involved in adhesion and biofilm development . Biofilms represent a protected growth mode that enhances resistance to antifungal drugs and host immune defenses, contributing significantly to the persistence of C. albicans infections.

  • Cell Wall Remodeling: Through regulation of pH-responsive genes like PHR1 and PHR2, the RIM21-dependent pathway controls cell wall composition in response to environmental pH . PHR1 is expressed at neutral-alkaline pH, while PHR2 is expressed under acidic conditions. This pH-dependent remodeling affects cell shape, integrity, and interactions with host surfaces.

  • Immune Evasion: By adapting to host microenvironments, RIM21-mediated signaling helps C. albicans evade immune recognition and clearance. Cell wall changes can alter pathogen-associated molecular pattern (PAMP) exposure, influencing recognition by immune cells.

The invasive candidiasis resulting from C. albicans dissemination carries a mortality rate of approximately 50% even with optimal treatment , highlighting the clinical significance of understanding and potentially targeting the RIM21-mediated environmental adaptation mechanisms.

What structural biology approaches could reveal the pH-sensing mechanism of RIM21?

Advanced structural biology approaches that could reveal the pH-sensing mechanism of RIM21 include:

These approaches would help determine whether RIM21 senses pH directly through protonation/deprotonation of specific residues or indirectly through changes in membrane properties, clarifying the fundamental mechanism of this important environmental sensor.

How can systems biology approaches enhance our understanding of RIM21's role in the fungal pH response network?

Systems biology approaches can dramatically enhance our understanding of RIM21's role in the fungal pH response network through comprehensive, integrative analyses:

  • Multi-omics Integration:

    • Combined analysis of transcriptomics, proteomics, phosphoproteomics, and metabolomics data from wild-type and rim21Δ strains under various pH conditions

    • Temporal profiling to capture dynamic changes following pH shifts

    • Network analysis to identify key regulatory hubs connected to RIM21 signaling

  • Mathematical Modeling:

    • Develop quantitative models of the Rim pathway incorporating known kinetic parameters

    • Use sensitivity analysis to identify critical control points in the network

    • Create predictive models of pathway activation under different environmental conditions

  • Genome-wide Interaction Studies:

    • Synthetic genetic array (SGA) analysis with rim21Δ to identify genetic interactions

    • Chemical-genetic screens to find compounds that specifically affect RIM21-dependent processes

    • Protein-protein interaction mapping using BioID or APEX proximity labeling

  • Single-cell Analyses:

    • Single-cell RNA-seq to identify cell-to-cell variability in RIM21-dependent responses

    • Microfluidics-based single-cell phenotyping under dynamic pH environments

    • Live-cell imaging of pathway components to capture stochastic activation events

  • Comparative Systems Analysis:

    • Cross-species comparison of pH response networks, including those with RIM21 (ascomycetes) and those with alternative sensors like Rra1 (basidiomycetes)

    • Evolutionary analysis to identify conserved core components versus species-specific adaptations

These approaches would place RIM21 in the broader context of cellular signaling networks, revealing how this sensor coordinates with other environmental response pathways and how its function has evolved across fungal lineages to suit different ecological niches.

What novel experimental techniques could advance research on RIM21-dependent antifungal resistance?

Novel experimental techniques that could significantly advance research on RIM21-dependent antifungal resistance include:

  • CRISPR-Based Technologies:

    • CRISPR interference (CRISPRi) for tunable repression of RIM21 expression

    • Base editing to introduce specific mutations without complete gene knockout

    • CRISPR-mediated homology-directed repair for precise genome modifications

    • CRISPR activation (CRISPRa) to upregulate RIM21 or downstream components

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize RIM21 distribution during drug exposure

    • Förster resonance energy transfer (FRET) sensors to detect RIM21 activation in real-time

    • Correlative light and electron microscopy (CLEM) to connect RIM21 localization with ultrastructural changes

  • Microfluidic Approaches:

    • Microfluidic devices for precise control of drug gradients and pH environments

    • Single-cell tracking to monitor heterogeneous responses to antifungals

    • Microbial evolution on chips to study resistance development in controlled environments

  • In Vivo Infection Models:

    • Transparent zebrafish embryo models for visualization of C. albicans adaptation during infection

    • Intravital microscopy in mouse models to track C. albicans behavior in real tissue environments

    • Organoid infection models that recapitulate human tissue architecture

  • High-Throughput Drug Discovery Platforms:

    • Targeted compound libraries screening against RIM21 and Rim pathway components

    • AI-driven drug design targeting the RIM21 sensing mechanism

    • Combination drug screens to identify synergistic compounds that enhance antifungal efficacy in rim pathway-dependent manner

  • Patient-Derived Xenograft Models:

    • Studying clinical isolates with varying RIM21 pathway activity in immunocompromised mice

    • Testing personalized treatment approaches based on Rim pathway activity signatures

These innovative approaches would provide new insights into how RIM21 influences antifungal resistance in clinically relevant contexts and accelerate the development of therapeutic strategies targeting this pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.