Recombinant Candida albicans pH-response regulator protein palI/RIM9 (RIM9)

Shipped with Ice Packs
In Stock

Description

Function and Role in pH Sensing

RIM9 functions as a key component of the pH sensing machinery in C. albicans. It acts as a transmembrane sensor that detects changes in external pH and initiates appropriate cellular responses . The protein is specifically involved in the Rim pathway, which is responsible for detecting and responding to neutral-alkaline pH conditions .

In the pH sensing mechanism, RIM9 forms a complex with another transmembrane protein, RIM21/DFG16, creating a detection system on the cell surface . Under neutral-alkaline conditions, the arrestin-like protein RIM8 interacts with this complex and becomes hyperphosphorylated, which triggers endocytosis of the membrane complex and recruitment of endosomal sorting complexes required for transport (ESCRT) I, II, and III . This cascade ultimately leads to the activation of the transcription factor RIM101, which regulates the expression of target genes involved in multiple cellular processes .

Research has demonstrated that RIM9 is essential for the proper response to environmental pH changes, particularly in the context of morphological transitions between yeast and hyphal forms, which are critical for C. albicans pathogenicity .

The RIM Pathway Mechanism

The RIM pathway represents a sophisticated signaling cascade that enables C. albicans to adapt to varying pH conditions encountered within host tissues. The pathway is highly conserved among fungi and plays a crucial role in their pathogenesis and virulence .

Components and Signaling Cascade

The key components of the RIM pathway include:

ComponentFunction
RIM9/PalITransmembrane pH sensor protein
RIM21/DFG16Transmembrane protein that forms complex with RIM9
RIM8Arrestin-like protein that becomes hyperphosphorylated upon pH change
RIM20Scaffold protein that facilitates proteolytic activation
RIM13Signaling protease that cleaves RIM101
RIM101Transcription factor that regulates pH-responsive genes

The cascade begins when the RIM9-RIM21 complex senses neutral-alkaline pH conditions . This activates RIM8, leading to a series of molecular interactions that culminate in the proteolytic cleavage of RIM101's C-terminal inhibitory domain by RIM13 . Once activated, RIM101 migrates to the nucleus where it regulates the expression of genes involved in various cellular processes including growth, iron metabolism, cell wall structure, yeast-to-hypha transition, adhesion, and biofilm formation .

Regulatory Mechanisms

The expression of RIM9 and other components of the pathway is itself regulated by environmental pH. Research has shown that RIM101 is expressed in a pH-conditional manner and its induction at alkaline pH is controlled by PRR1 (a homolog of palF), establishing a pH-dependent feedback loop . This feedback mechanism ensures appropriate responses to changing pH conditions, allowing C. albicans to adapt effectively to different host niches.

Role in Candida albicans Pathogenesis

C. albicans colonizes and infects various host sites with diverse environmental pH conditions. The ability to adapt to these varying pH environments is crucial for its success as both a commensal organism and a pathogen .

Morphological Transitions

One of the most significant contributions of RIM9 to C. albicans pathogenicity is its role in regulating morphological transitions. C. albicans can switch between yeast and hyphal forms, a capability that is essential for its virulence . Research has demonstrated that the RIM pathway influences this transition in response to environmental pH signals .

Recent studies have identified novel regulatory pathways that work in conjunction with the RIM pathway. For instance, the Rfg1-Bcr1 regulatory pathway has been found to govern acidic pH responses and regulate filamentation in C. albicans . This pathway operates in parallel with the RIM pathway to ensure appropriate morphological responses across a wide pH range.

Antifungal Tolerance

The RIM pathway has been implicated in mediating tolerance to antifungal drugs in C. albicans. Research has shown that genetic inhibition of all RIM factors, including RIM9, enhances the activity of echinocandin and azole antifungals . This finding suggests that the RIM pathway plays a critical role in stress adaptation mechanisms that enable C. albicans to survive antifungal treatment.

Transcriptomic analysis has revealed that RIM101, the terminal transcription factor in the pathway, regulates genes involved in antifungal tolerance, including HSP90 (encoding a major molecular chaperone) and IPT1 (involved in sphingolipid biosynthesis) . These findings indicate that targeting the RIM pathway, including RIM9, could potentially enhance the efficacy of existing antifungal drugs.

Comparative Analysis with Other Fungal Species

The RIM pathway is highly conserved among fungal species, though with some variations in structure and function. Comparative studies between C. albicans and other fungi have provided valuable insights into the evolution and specialization of this pathway.

Differences Between RIM9/PalI in Various Fungi

Research comparing RIM9/PalI proteins across different fungal species has revealed interesting patterns. In fungi such as Aspergillus nidulans that contain only a long-form PalI-like protein, this element functions in the process of stress response . In contrast, in fungi like S. cerevisiae and C. albicans that possess both short and long versions, the response to stress function appears to be limited to the short-form protein (RIM9) .

Studies examining the roles of these proteins in S. cerevisiae and C. albicans found that deletions of the long-form genes (YOL019w in S. cerevisiae and ORF19.1510/SRD1 in C. albicans) did not create any significant stress response phenotype in either species, nor did the deletions enhance any of the RIM9 deletion effects when combined in a double mutant . Furthermore, challenge experiments in C. albicans demonstrated that RIM9, but not SRD1, is important for proper pH response and hyphal formation .

Evolutionary Conservation

The conservation of the RIM pathway across diverse fungal species underscores its fundamental importance in fungal biology. The pathway has been identified in both ascomycetes (including A. nidulans, S. cerevisiae, and C. albicans) and basidiomycetes . This conservation suggests that pH adaptation mechanisms emerged early in fungal evolution and have been maintained due to their critical role in environmental adaptation.

Laboratory Applications and Protein Characteristics

Recombinant C. albicans RIM9 protein is a valuable tool for laboratory research focused on understanding fungal pH sensing mechanisms and developing novel antifungal strategies.

Production and Purification

The recombinant full-length C. albicans RIM9 protein (Q59WV0) is typically produced with an N-terminal His tag in E. coli expression systems . The protein is purified to greater than 90% purity as determined by SDS-PAGE analysis . The resulting product is a lyophilized powder that requires careful handling and reconstitution for experimental use.

Potential Therapeutic Applications

The involvement of RIM9 and the broader RIM pathway in C. albicans pathogenesis and antifungal tolerance suggests potential therapeutic applications targeting this pathway.

RIM Pathway as an Antifungal Target

Research has demonstrated that the RIM pathway is fungus-specific and plays key roles in pathogenesis and virulence . This specificity makes it an attractive target for antifungal drug development, as targeting components of this pathway would likely have minimal effects on human host cells.

Studies have shown that genetic inhibition of all RIM factors enhances the activity of existing antifungal drugs, suggesting that targeting the RIM pathway could be a promising strategy for combination therapy . By disrupting the fungal cell's ability to adapt to changing pH conditions, such therapies could potentially enhance the efficacy of current antifungal treatments.

Indirect Targeting of Stress Response Mechanisms

The RIM pathway has been shown to regulate important stress response mechanisms in C. albicans, including the expression of HSP90, a major molecular chaperone involved in antifungal tolerance . This suggests that targeting the RIM pathway could provide a means to indirectly but specifically target these stress response mechanisms in yeasts.

RNA sequencing analysis has revealed that RIM101, the terminal transcription factor in the RIM pathway, regulates numerous genes involved in stress adaptation and antifungal tolerance . This regulatory network presents multiple potential targets for therapeutic intervention.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preferences when placing the order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Please note that all our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
RIM9; CAALFM_C600990WA; CaO19.101; CaO19.7748; pH-response regulator protein palI/RIM9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-346
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
RIM9
Target Protein Sequence
MFKAFIALLILLIVCWVIQLLPVIAVPFTTPDANIYLSYYNNYRFGVFGICNVERHICSK PSIGYPSTNSTFYAYDNDESFGTGGIVLPSDVRYTISKLLVVHVVAFCFSSLLLIVIFGL IIILFFKYIKTKKDLEDIQLNDSSHEITIHSDEEDNNNNNIDNTNHNNKRASVTINKTIF DLTPFLNLMLVFTFFSVLTTLLAFLADILLFTPNLSYLGWLQLIPIVSMALVTSMLCFIE RSISSRKFFESEYRYANDDMRIMRKTYVDEFWNDNASDDGFYVYTDGFYTRNGDNVQQPT SNTAGSLLSEHHDVSIVEPRTFLDTDDSRRGSSPHEFIELQNLRPV
Uniprot No.

Target Background

Function
Essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Database Links
Protein Families
PalI/RIM9 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Candida albicans RIM9 protein?

RIM9 is a transmembrane protein that functions as part of the pH-sensing complex in the Rim pathway of Candida albicans. The full-length protein consists of 346 amino acids and contains multiple transmembrane domains. The protein sequence (AA sequence: MFKAFIALLILLIVCWVIQLLPVIAVPFTTPDANIYLSYYNNYRFGVFGICNVERHICSKPSIGYPSTNSTFYAYDNDESFGTGGIVLPSDVRYTISKLLVVHVVAFCFSSLLLIVIFGLIIILFFKYIKTKKDLEDIQLNDSSHEITIHSDEEDNNNNNIDNTNHNNKRASVTINKTIF DLTPFLNLMLVFTFFSVLTTLLAFLADILLFTPNLSYLGWLQLIPIVSMALVTSMLCFIERSISSRKFFESEYRYANDDMRIMRKTYVDEFWNDNASDDGFYVYTDGFYTRNGDNVQQPT SNTAGSLLSEHHDVSIVEPRTFLDTDDSRRGSSPHEFIELQNLRPV) contains regions essential for its function in pH sensing .

Functionally, RIM9 forms a complex with Rim21/Dfg16 in the cell membrane to sense changes in external pH. Under neutral-alkaline conditions, this complex interacts with the arrestin-like protein Rim8, eventually leading to the activation of the transcription factor Rim101 through a proteolytic cleavage mechanism .

How does the Rim pathway function in Candida albicans pH response?

The Rim pathway in C. albicans operates through a sequence of molecular events:

  • External pH is sensed by a complex of two transmembrane proteins, Rim9 and Rim21/Dfg16, along with the arrestin-like protein Rim8

  • Under neutral-alkaline conditions, Rim8 becomes hyperphosphorylated, leading to endocytosis of this membrane complex and recruitment of endosomal sorting complexes required for transport (ESCRT) I, II, and III

  • Rim20 and the signaling protease Rim13 are then recruited

  • This leads to cleavage of the C-terminal inhibitory domain of Rim101, the final transcription factor of the Rim pathway

  • Activated Rim101 migrates to the nucleus and regulates expression of target genes involved in multiple cellular processes

This pathway is crucial for adaptation to environmental pH and regulates processes including growth, iron metabolism, cell wall structure, yeast-to-hypha transition, adhesion, and biofilm formation, all of which contribute to pathogenesis and virulence .

What is the relationship between RIM9 and antifungal tolerance in C. albicans?

Research has established that the entire Rim pathway, including RIM9, mediates tolerance to both azole and echinocandin antifungal drugs in C. albicans. Time-kill curve experiments and colony formation tests have demonstrated that genetic inhibition of all Rim factors, including RIM9, enhances the activity of antifungals like fluconazole, voriconazole, posaconazole, micafungin, and anidulafungin .

Importantly, while minimum inhibitory concentrations (MICs) for these drugs remain unchanged in rim mutants compared to control strains, the mutants show increased susceptibility in tolerance assays. This suggests the Rim pathway's role is in tolerance rather than resistance to these antifungals . This distinction is crucial for understanding potential therapeutic approaches targeting this pathway.

How should researchers reconstitute and store recombinant RIM9 protein for optimal activity?

For optimal handling of recombinant RIM9 protein:

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

    • Long-term storage should be in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

This approach maintains protein stability and activity for extended periods, which is essential for consistent experimental results.

What expression systems are commonly used for producing recombinant RIM9, and what are their comparative advantages?

Several expression systems are used for recombinant RIM9 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical Purity
E. coliCost-effective, high yield, rapid expressionMay lack post-translational modifications, potential inclusion bodies>90% (SDS-PAGE)
YeastNative-like folding, post-translational modificationsLower yield than E. coli, longer expression time>85% (SDS-PAGE)
BaculovirusComplex eukaryotic modifications, high expression levelsTechnical complexity, higher cost>85% (SDS-PAGE)
Mammalian CellMost authentic post-translational modificationsHighest cost, longest production time>85% (SDS-PAGE)
Cell-Free ExpressionRapid production, avoids cytotoxicity issuesLimited post-translational modifications>85% (SDS-PAGE)

What experimental approaches are most effective for studying RIM9's role in pH sensing?

To effectively study RIM9's role in pH sensing, researchers typically employ a multi-faceted approach:

  • Genetic manipulation:

    • PCR product-disruption mutations in RIM9 to assess pH-dependent phenotypes

    • Complementation studies to confirm phenotype specificity

    • Creation of strains with constitutive RIM101 expression to bypass upstream components

  • Phenotypic assays:

    • Filamentation assays at varying pH values

    • Gene expression analysis of pH-responsive genes (e.g., PHR1, PHR2, PRA1)

    • Colony formation tests on media at different pH values

  • Transcriptome analysis:

    • RNA sequencing to identify genes regulated by the Rim pathway

    • Intersample distance clustering to assess similarity between experimental conditions

    • Principal component analysis to validate transcriptional patterns

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to confirm interactions between Rim9 and other components

    • Membrane fractionation to localize Rim9 in cellular compartments

    • Phosphorylation analysis to track activation states of pathway components

These approaches, when used in combination, provide comprehensive insights into RIM9's function in pH sensing and subsequent cellular responses.

How does environmental pH affect the expression and function of RIM9 in C. albicans virulence?

Environmental pH critically influences RIM9 function and its contribution to virulence through multiple mechanisms:

  • pH-dependent gene regulation:

    • At neutral-alkaline pH, the Rim pathway (including RIM9) activates genes required for adaptation, including PHR1 and represses PHR2

    • At acidic pH, the Rim pathway is less active, allowing expression of acid-responsive genes

  • Impact on morphogenesis:

    • The Rim pathway regulates filamentation in response to alkaline pH

    • Defects in RIM9 or other Rim factors impair hyphal formation at alkaline pH, a critical virulence trait

    • Recent studies have identified a novel Rfg1-Bcr1 regulatory pathway that governs acidic pH responses and regulates filamentation, operating in parallel to the Rim pathway

  • Tissue-specific virulence:

    • Rim pathway mutants show tissue-specific virulence defects

    • Mutants in PHR2 (regulated by the Rim pathway) are avirulent in rodent vaginitis models (acidic environment) but remain virulent in bloodstream infection models

    • Conversely, mutants in PHR1 (also regulated by the Rim pathway) are attenuated in bloodstream infections but not in vaginal infections

  • Iron acquisition:

    • Alkaline pH induces iron starvation conditions

    • The Rim pathway upregulates iron acquisition genes at alkaline pH

    • Rim101p-dependent adaptation to alkaline pH helps cells cope with iron limitation, which is crucial for virulence

These findings illustrate how pH-dependent regulation through the Rim pathway (including RIM9) allows C. albicans to adapt to diverse host niches, directly impacting its virulence potential.

What are the methodological approaches for investigating the interaction between RIM9 and other components of the Rim pathway?

Investigating the interactions between RIM9 and other Rim pathway components requires sophisticated methodological approaches:

  • Co-immunoprecipitation with quantitative analysis:

    • Epitope-tag RIM9 and other Rim proteins (Rim8, Rim21/Dfg16)

    • Perform co-immunoprecipitation under different pH conditions

    • Analyze by western blotting and quantify band intensities

    • Mass spectrometry analysis of immunoprecipitated complexes can identify novel interacting partners

  • Membrane topology analysis:

    • Use protease protection assays to determine orientation of RIM9 domains

    • Analyze glycosylation patterns to identify luminal domains

    • Apply fluorescence resonance energy transfer (FRET) to analyze proximity of different Rim proteins in live cells

  • Functional domain mapping:

    • Generate truncated versions of RIM9 to identify regions required for interaction

    • Site-directed mutagenesis of key residues followed by functional assays

    • Create chimeric proteins with domains from related fungal species to identify species-specific interaction determinants

  • Live-cell imaging of pathway activation:

    • Fluorescently tag RIM9 and other components

    • Track protein localization and complex formation in response to pH shifts

    • Quantify endocytosis rates of the receptor complex under different conditions

  • Crosslinking studies:

    • Apply chemical crosslinking followed by mass spectrometry to capture transient interactions

    • In vivo photo-crosslinking using genetically encoded photo-crosslinkable amino acids can provide spatial information on protein complexes

These approaches provide complementary information about the dynamic assembly, composition, and function of the pH-sensing complex involving RIM9.

How do pH-dependent activities of RIM9 correlate with detection of virulence factors secreted by C. albicans?

The correlation between pH-dependent activities of RIM9 and secreted virulence factors displays intricate patterns:

  • Protease secretion:

    • Proteolytic activity is predominantly detected at pH 5 (80% of isolates) and pH 6.5 (75%)

    • On BSA-containing media, protease detection is exclusive to pH 5 (80% of isolates)

    • The Rim pathway influences this pH-dependent regulation of proteases

  • Lipolytic activities:

    • Lipolytic activities show pH dependence with higher detection at pH 5 (90%) compared to pH 6.5 (70%) and pH 7.5 (35%)

    • This suggests acidic pH optimization for lipases, contrasting with the alkaline pH preference of the Rim pathway

  • Hemolytic activities:

    • Hemolytic activities display an inverse pattern, detected in all isolates at pH 6.5 and 7.5 but not at pH 5

    • This correlates with Rim pathway activation at neutral-alkaline pH

  • Impact of RIM9 on virulence factor regulation:

    • Rim pathway mutants show altered secretion profiles due to dysregulation of pH-responsive genes

    • The pathway may indirectly affect virulence factor secretion through its influence on cellular adaptation to pH changes

    • Strain-specific differences exist, as demonstrated by varying protease secretion patterns among reference strains at different pH values

These findings highlight the critical role of environmental pH in regulating virulence factor expression and activity, with the Rim pathway (including RIM9) serving as an important mediator of these responses.

How is RIM9 structure and function conserved across different fungal species?

RIM9 shows significant conservation across fungal species, with some notable variations:

Fungal SpeciesGene IDUnique FeaturesFunction
Candida albicansRIM9346 amino acidspH sensing, antifungal tolerance
Saccharomyces cerevisiaeRIM9Close homology to C. albicanspH response regulation
Candida glabrataCAGL0F06545gIdentified as "uncharacterized protein"pH-response regulation
Debaryomyces hanseniiDEHA2E21252g-pH sensing
Kluyveromyces lactisKLLA0_A04389gDescribed as "pH-response regulator palI/RIM9 homolog 1"pH sensing
Magnaporthe oryzaeMGG_02630Plant pathogen variantpH sensing in plant infection
Emericella nidulansAN4853.2 (palI)Homolog of RIM9 in filamentous fungipH sensing
Yarrowia lipolyticaYALI0E33627g-pH sensing
Ashbya gossypiiAGOS_ADR141W-pH sensing

This conservation reflects the fundamental importance of pH adaptation across the fungal kingdom . The Rim pathway is functionally conserved despite some structural differences in the proteins, underscoring its evolutionary significance in fungal biology.

The pH-response mechanism mediated by the Rim pathway appears to be a fundamental adaptation in fungi that has been maintained through evolution, despite the diverse ecological niches these species occupy. This conservation suggests that targeting this pathway could potentially provide broad-spectrum antifungal strategies.

What experimental approaches can distinguish between RIM101-dependent and RIM101-independent pH response pathways in C. albicans?

To differentiate between RIM101-dependent and RIM101-independent pH response pathways:

  • Genetic dissection:

    • Create strains with constitutively active Rim101p that functions independently of upstream factors (Rim9, Rim8, etc.)

    • Analyze pH-dependent phenotypes in these strains compared to wild-type and rim101-null strains

    • Observe which pH responses remain pH-dependent despite constitutive Rim101p activation

  • Gene expression analysis:

    • Perform transcriptome profiling at different pH values in wild-type, rim101-null, and constitutive RIM101 strains

    • Identify genes that maintain pH-dependent expression even in the presence of constitutively active Rim101p

    • Cluster genes based on their expression patterns to identify Rim101-dependent and independent regulons

  • Specific gene reporters:

    • Monitor expression of PHR2, which becomes alkaline-induced in rim mutants (indicating an alternative regulatory mechanism)

    • Use reporter constructs to track activity of both pathways simultaneously in single cells

    • Analyze the kinetics of gene expression in response to pH shifts

  • Functional phenotyping:

    • Assess filamentation at different pH values, which remains pH-dependent even in strains with Rim101p activity independent of Rim9/Rim8

    • Evaluate other pH-dependent phenotypes like biofilm formation and stress responses

    • Compare growth patterns at different pH values and in the presence of various stressors

These approaches have revealed that pH governs gene expression and cellular differentiation in C. albicans through both RIM101-dependent and RIM101-independent pathways, with some processes like filamentation showing dual regulation .

What are common challenges in working with recombinant RIM9 protein, and how can they be addressed?

Researchers working with recombinant RIM9 protein frequently encounter several challenges:

  • Protein solubility issues:

    • Challenge: As a membrane protein, RIM9 has hydrophobic domains that can cause aggregation

    • Solution: Use mild detergents (0.1% n-dodecyl β-D-maltoside or CHAPS) during purification

    • Alternative: Express soluble domains separately for functional studies

  • Maintaining native conformation:

    • Challenge: Loss of native structure during purification

    • Solution: Optimize buffer conditions (pH 8.0 appears optimal for storage)

    • Approach: Include 6% trehalose as a stabilizing agent in storage buffer

  • Activity assessment:

    • Challenge: Difficult to measure functional activity of isolated protein

    • Solution: Develop binding assays with other Rim pathway components

    • Alternative: Use partial proteolysis to assess proper folding

  • Freeze-thaw instability:

    • Challenge: Activity loss during freeze-thaw cycles

    • Solution: Store working aliquots at 4°C for up to one week

    • Recommendation: Add 50% glycerol for long-term storage at -20°C/-80°C

  • Expression system selection:

    • Challenge: Balancing yield with proper folding and modifications

    • Solution: For structural studies, E. coli expression provides sufficient quantity

    • Alternative: For functional studies, consider yeast or mammalian expression systems

By addressing these challenges systematically, researchers can optimize their work with recombinant RIM9 protein and obtain more reliable experimental results.

How can researchers design experiments to investigate the role of RIM9 in antifungal drug development?

Designing experiments to investigate RIM9's potential in antifungal drug development requires a multi-faceted approach:

  • High-throughput screening strategy:

    • Develop a reporter strain with fluorescent output linked to Rim pathway activation

    • Screen compound libraries for molecules that disrupt RIM9 function

    • Validate hits with secondary assays measuring pH adaptation and antifungal susceptibility

  • Structure-based drug design:

    • Determine the crystal or cryo-EM structure of RIM9 and its interaction interfaces

    • Perform in silico screening to identify potential binding pockets

    • Design small molecules that can disrupt RIM9's interaction with other Rim proteins

  • Combinatorial therapy assessment:

    • Test combinations of Rim pathway inhibitors with existing antifungals

    • Measure synergy using checkerboard assays and time-kill curves

    • Determine if RIM9 inhibition can overcome existing antifungal tolerance mechanisms

  • Target validation experiments:

    • Create conditional RIM9 mutants to confirm essentiality under infection-relevant conditions

    • Use CRISPR interference to achieve dose-dependent downregulation of RIM9

    • Validate that chemical inhibition phenocopies genetic inhibition

  • Selectivity profiling:

    • Compare effects of potential inhibitors on fungal RIM9 versus human proteins

    • Assess activity against RIM9 homologs in different pathogenic fungi

    • Measure cytotoxicity in mammalian cell lines

  • In vivo efficacy models:

    • Test promising compounds in murine models of candidiasis

    • Assess drug pharmacokinetics and penetration into relevant tissues

    • Determine if RIM9 inhibition enhances existing antifungal efficacy in vivo

This systematic approach could potentially identify novel antifungal strategies by targeting the Rim pathway, which has been shown to mediate tolerance to both echinocandins and azoles in C. albicans .

What are the most promising research directions for understanding the intersection of RIM9 function, pH adaptation, and C. albicans pathogenesis?

Several emerging research directions hold particular promise for advancing our understanding of RIM9's role in C. albicans pathogenesis:

  • Host-pathogen interface studies:

    • Investigate how C. albicans actively modifies host microenvironment pH through ammonia extrusion

    • Examine how RIM9 senses these self-induced pH changes to coordinate virulence expression

    • Develop models to study the spatial and temporal dynamics of pH changes during infection

  • Integration with other stress response pathways:

    • Map the crosstalk between the Rim pathway and other stress response networks

    • Investigate how RIM9 function intersects with the newly identified Rfg1-Bcr1 regulatory pathway that governs acidic pH responses

    • Determine how pH sensing through RIM9 coordinates with responses to other host-relevant stresses

  • Single-cell analysis of heterogeneous responses:

    • Apply single-cell transcriptomics to understand population heterogeneity in pH responses

    • Develop microfluidic systems to track individual cell fate decisions in response to pH fluctuations

    • Correlate RIM9 activity with cell-to-cell variations in antifungal tolerance

  • Tissue-specific adaptation mechanisms:

    • Compare RIM9 function in different host niches (oral, vaginal, bloodstream)

    • Investigate tissue-specific virulence factor regulation downstream of RIM9

    • Develop organ-on-chip models to study pH adaptation in tissue-specific microenvironments

  • Iron metabolism connection:

    • Further explore the link between alkaline pH, iron acquisition, and RIM9 function

    • Investigate how the Rim pathway coordinates pH and iron sensing to optimize virulence

    • Develop dual-targeting strategies aimed at both pH adaptation and iron acquisition pathways

  • Evolutionary adaptation studies:

    • Compare RIM9 function across clinical isolates with varying virulence properties

    • Investigate how RIM9 sequence variations affect pH adaptation and antifungal tolerance

    • Apply experimental evolution under pH stress to identify adaptive mutations in RIM9 and related genes

These research directions offer significant potential to deepen our understanding of C. albicans pathogenesis and may reveal novel intervention strategies against this important fungal pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.