Recombinant Candida albicans Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Candida albicans Presequence Translocated-Associated Motor Subunit PAM17, Mitochondrial (PAM17)

Recombinant Candida albicans Presequence Translocated-Associated Motor Subunit PAM17, mitochondrial (PAM17), is a protein involved in the mitochondrial protein import process. While specific research on the recombinant form of PAM17 from Candida albicans is limited, understanding its role in mitochondrial protein import can be inferred from studies on its homologs in other organisms, particularly in yeast like Saccharomyces cerevisiae.

PAM17 is part of the Presequence Translocase-Associated Motor (PAM) complex, which plays a crucial role in the translocation of proteins across the mitochondrial inner membrane. The PAM complex includes several subunits, such as mtHsp70, Pam16, Pam18, and Tim44, each contributing to the efficient import of proteins into the mitochondrial matrix.

Function of PAM17 in Mitochondrial Protein Import

PAM17 is involved in an early stage of protein translocation into the mitochondria. It interacts with the Tim23 presequence translocase, which forms a channel for protein import across the inner mitochondrial membrane . The interaction between PAM17 and Tim23 is crucial for the efficient import of preproteins into the mitochondrial matrix.

ProteinFunction in Mitochondrial Protein Import
PAM17Involved in early stages of protein translocation, interacts with Tim23 .
Tim44Acts as a scaffold for mtHsp70, involved in later stages of protein translocation .
mtHsp70Central motor driving protein translocation through ATP hydrolysis .
Pam16/Pam18Co-chaperones regulating mtHsp70 activity .

Interaction with Other PAM Complex Subunits

PAM17 interacts with other components of the PAM complex, including Tim44 and the J-protein complex (Pam16-Pam18). While Tim44 is essential for recruiting mtHsp70 to the translocase and facilitating later stages of protein import, PAM17's role is more nuanced. In the absence of functional Tim44, PAM17's association with the Tim23 complex increases, suggesting a compensatory mechanism .

3.1. Impact of Tim44 on PAM17 Association

The alteration of Tim44 function leads to a dual effect on the PAM complex: it diminishes the association of the J-complex (Pam16-Pam18) with the Tim23 translocase while enhancing the binding of PAM17 to Tim23. This indicates that PAM17 and the J-complex interact with the Tim23 complex through different sites and are regulated differently by Tim44 .

Research Findings and Implications

Research on PAM17 highlights its role in posttranslational protein import into mitochondria. The deletion of PAM17 in yeast results in an import defect for certain matrix-targeted precursors, although cells generally grow normally under most conditions . This suggests that while PAM17 is not essential for viability, it contributes to the efficiency of protein import.

ConditionEffect on Protein Import
Wild-typeEfficient protein import .
PAM17 deletionDefect in posttranslational import of selected precursors .
Tim44 mutationIncreased PAM17 association with Tim23, decreased J-complex association .

References - Pam17 and Tim44 act sequentially in protein import into the mitochondria. - Mitochondrial Protein Import Motor: Differential Role of Tim44 in the Recruitment of Pam17 and J-Complex to the Presequence Translocase. - Presequence translocase-associated motor subunits of mitochondria. - Mitochondrial Protein Import Motor: Differential Role of Tim44 in the Recruitment of Pam17 and J-Complex to the Presequence Translocase.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PAM17; CAALFM_C302500WA; CaO19.240; CaO19.7870; Presequence translocated-associated motor subunit PAM17, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
53-185
Protein Length
Full Length of Mature Protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
PAM17
Target Protein Sequence
NTIAGVFTGLGGAFITLSYLGNIEIDVEKPIMGFDPLMVMGGAVILGGLVGFLVGPFIGS SIFRLTNRAQLKQFELKNTEFLSRLRIKRPDPSSQSFSNPIPDYYGEKIYSLKDYKQWLR DCNAFRRKSKEFL
Uniprot No.

Target Background

Function
A component of the PAM complex, essential for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the mitochondrial matrix.
Database Links
Protein Families
PAM17 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.