Recombinant Candida albicans Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
LCL3; CAWG_00075; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Candida albicans (strain WO-1) (Yeast)
Target Names
LCL3
Target Protein Sequence
MPPIPAEPTENISIFHPKVLLLSAGVTTSLFFGYKFYKRYIKRIRTYLDLTPSIIENNTK LYGYVTRVGDGDNFRFYHTPGGWFFGWGWLRKIPTTRKDLKDETLMIRLCGVDAPEGAHF GKPAQPYSKEALYWLREYVDGKYVTITPYSIDQYKRVVARAQIWKWTGRKDVSAEMLKVG YAIVYEGKAEAEFGDNEDWYRKLESRAKLLRKGVWSLGKNLTTPGEFKRIHYRGE
Uniprot No.

Target Background

Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is LCL3 in Candida albicans?

LCL3 (Probable endonuclease LCL3) is a protein encoded by the LCL3 gene in Candida albicans, a major opportunistic fungal pathogen causing both superficial and invasive infections in immunocompromised patients. The protein is classified as a probable endonuclease containing a Staphylococcal nuclease domain, suggesting its involvement in DNA or RNA processing activities. The protein is annotated in multiple databases including SGD (Saccharomyces Genome Database) and CGD (Candida Genome Database) as a probable endonuclease, indicating conserved functional predictions across fungal species . Current research positions LCL3 as one component of the complex molecular machinery that may contribute to C. albicans biology, though its precise role in pathogenesis remains under investigation.

What is the molecular structure and characteristics of LCL3?

LCL3 is a 250 amino acid protein with a predicted molecular weight of approximately 28 kDa based on its primary sequence. The protein contains a characteristic Staphylococcal nuclease domain, which typically confers nucleic acid degradation capabilities. This domain is highly conserved across various microbial species and represents the catalytic core of the protein .

The LCL3 gene in C. albicans strain SC5314 is located on contig C, spanning positions 2122621-2123374, and demonstrates moderate expression levels with RNA-seq data showing 813 read pairs, an FPKM (Fragments Per Kilobase Million) value of 40.0, and a percentile rank of 60.3% within the C. albicans transcriptome . This expression level suggests that LCL3 is constitutively produced under standard growth conditions, though likely not among the most highly expressed proteins.

How conserved is LCL3 across fungal species?

LCL3 demonstrates significant sequence conservation across multiple fungal species, suggesting an important biological role that has been maintained throughout evolutionary history. Sequence alignment analysis reveals the following homology relationships:

OrganismProtein IDSequence IdentityAlignment LengthE-value
Meyerozyma sp.MIA_02684_156.33%2296e-93
Geotrichum candidumA0A0J9XDF5_GEOCN54.55%2205e-74
Sugiyamaella lignohabitansA0A167DQP5_9ASCO53.67%2186e-68
Nadsonia fulvescensA0A1E3PLL8_9ASCO50.68%2216e-68
Blastobotrys adeninivoransA0A060T1U5_BLAAD47.77%2243e-63
Yarrowia lipolyticaLCL3_YARLI46.54%2172e-59
Candida albicans (SC5314)LCL3_CANAL46.30%2163e-58

This conservation pattern indicates that LCL3 likely performs a fundamental biological function across diverse fungal lineages, with sequence identity ranging from approximately 46% to 56% among the most closely related homologs . The strong conservation of sequence suggests that recombinant expression strategies successful for one fungal LCL3 might be adaptable for others.

What expression systems are optimal for recombinant production of Candida albicans LCL3?

For successful recombinant expression of C. albicans LCL3, several expression systems can be considered, each with distinct advantages:

Yeast Expression Systems:
For a protein of fungal origin like LCL3, Saccharomyces cerevisiae or Pichia pastoris may provide more appropriate folding environments with post-translational modifications. These systems offer the advantage of secretion into the medium, simplifying purification. For P. pastoris, strong inducible promoters like AOX1 can be used with vectors containing a secretion signal (α-factor) and affinity tags .

Candida albicans Expression System:
For studying LCL3 in its native context, homologous expression in C. albicans itself may be advantageous. Multiple selectable marker systems are available for C. albicans genetic manipulation, including URA3, HIS1, LEU2, and ARG4 auxotrophic markers. For instance, the URA3 flipper cassette containing FRT sequences and the FLP recombinase gene under SAP2 promoter control allows marker recycling and multiple genetic manipulations .

What are the key design considerations for LCL3 expression constructs?

When designing expression constructs for recombinant LCL3 production, researchers should consider several critical factors:

Promoter Selection:

  • For heterologous expression: Strong constitutive promoters (T7 for E. coli; GAL1 for S. cerevisiae; AOX1 for P. pastoris)

  • For homologous expression in C. albicans: Either constitutive promoters (ACT1, ENO1) or regulatable promoters (MET3, GAL1) depending on experimental needs

  • For functional studies in C. albicans: Consider maintaining the native LCL3 promoter to preserve physiological expression patterns

Selection Markers and Cassette Design:
For C. albicans manipulations, several marker systems exist with distinct advantages:

  • URA3-based systems: Utilize the orotidine 5′-monophosphate decarboxylase enzyme for selection on uracil-deficient media. Note that URA3 position effects can influence virulence phenotypes

  • URA flipper cassette: Includes FRT sites and FLP recombinase for marker recycling

  • Multi-marker systems: HIS1, LEU2, or ARG4 markers from C. dubliniensis or C. maltosa can be used in appropriate auxotrophic strains (e.g., SN87, SN95, SN152)

Affinity Tags:
Position affinity tags (His, GST, MBP) strategically to minimize interference with enzymatic activity. For nucleases like LCL3, C-terminal tags may be preferable to avoid disrupting the N-terminal catalytic domain.

Codon Optimization:
C. albicans uses a non-standard genetic code where CTG codons encode serine instead of leucine. When expressing in standard systems, codon optimization is essential to prevent mistranslation and potential protein misfolding .

What purification approaches are recommended for recombinant LCL3?

Purification of recombinant LCL3 requires careful consideration of its nuclease properties. The following methodological approach is recommended:

Initial Capture:

  • Affinity chromatography based on fusion tags (Ni-NTA for His-tagged proteins, glutathione for GST-fusion)

  • Include nuclease inhibitors (EDTA at 1-5 mM) in lysis buffers to prevent degradation of nucleic acids and contamination of samples

  • Use low salt conditions initially (100-150 mM NaCl) to maintain protein solubility

Intermediate Purification:

  • Ion exchange chromatography: Based on the theoretical pI of LCL3

  • Consider cation exchange (SP-Sepharose) if working at pH below the pI

  • Anion exchange (Q-Sepharose) if working at pH above the pI

Polishing Step:

  • Size exclusion chromatography to remove aggregates and achieve high purity

  • Typical columns include Superdex 75 or Superdex 200 depending on oligomerization state

Activity Preservation:

  • Include divalent cations (Mg²⁺, Ca²⁺) at 1-5 mM in final storage buffers as these are often required for nuclease activity

  • Consider adding stabilizers like glycerol (10-20%) to prevent aggregation

  • Store at -80°C in small aliquots to prevent freeze-thaw cycles

This purification strategy should yield highly pure recombinant LCL3 suitable for biochemical and structural studies.

How can gene manipulation techniques be applied to study LCL3 function in Candida albicans?

Elucidating LCL3 function in C. albicans requires sophisticated genetic approaches. Based on established C. albicans manipulation techniques, the following methodological workflow is recommended:

Gene Deletion Strategy:

  • Select an appropriate marker system based on your starting strain. For standard laboratory strains like SN152, the C. dubliniensis HIS1 and C. maltosa LEU2 markers are recommended for sequential deletion of both alleles

  • Design deletion cassettes with 50-100 bp homology regions flanking the LCL3 open reading frame

  • Amplify deletion cassettes using high-fidelity PCR and transform using the lithium acetate method with heat shock

  • Select transformants on appropriate selective media and confirm deletion by PCR, Southern blotting, and RT-PCR

Conditional Expression System:
For essential genes or to study phenotypes associated with varying expression levels:

  • Replace the native promoter with a regulatable promoter such as MET3 (repressed by methionine) or TET (tetracycline-regulatable)

  • Design the promoter replacement construct with appropriate homology regions

  • Confirm the integration and regulation by RT-PCR and Western blotting

Protein Tagging for Localization and Interaction Studies:

  • C-terminal tagging with GFP or epitope tags (HA, Myc) using PCR-generated cassettes

  • Select integration events on appropriate media

  • Confirm correct integration and expression by PCR and Western blotting

  • Perform fluorescence microscopy for localization or co-immunoprecipitation for interaction studies

Complementation Analysis:

  • Reintroduce wild-type or mutant versions of LCL3 at the RPS10 or ENO1 locus (neutral integration sites)

  • Use an alternative selectable marker for selection

  • Compare phenotypes of wild-type, deletion, and complemented strains to confirm specific effects

This comprehensive genetic manipulation approach enables detailed characterization of LCL3 function in C. albicans, providing insights into its biological role and potential contributions to virulence.

What potential roles might LCL3 play in Candida albicans pathogenesis?

As a probable endonuclease, LCL3 may contribute to several aspects of C. albicans pathogenesis, though direct evidence is currently limited. Based on roles of other nucleases and C. albicans virulence factors, the following hypothetical functions warrant investigation:

DNA/RNA Processing and Stress Response:

  • Nucleic acid damage repair during oxidative stress encountered in phagocytes

  • Processing of extracellular DNA/RNA as nutrient sources during infection

  • Potential role in biofilm formation, where extracellular DNA is a structural component

Host Immune Evasion:

  • Degradation of neutrophil extracellular traps (NETs), which are DNA-based antimicrobial structures

  • Processing of host nucleic acids that may trigger immune recognition

  • Modification of C. albicans surface-exposed nucleic acids to reduce recognition

Cell Wall Remodeling:
While not directly confirmed for LCL3, many surface-associated proteins in C. albicans contribute to cell wall structure and integrity, which influences immune recognition. Similar to well-characterized proteins like Hwp1 and Als3, LCL3 could potentially influence cell wall properties if it has cell-surface localization .

Potential Biomarker:
The conservation of LCL3 across fungal species but absence in humans makes it a potential biomarker candidate for diagnostic development, similar to other C. albicans antigens like enolase that have been investigated for serological detection of invasive candidiasis .

To definitively establish LCL3's role in pathogenesis, virulence studies comparing wild-type and lcl3Δ/lcl3Δ mutant strains in established models of candidiasis would be essential, followed by mechanistic studies to determine its precise biochemical function during infection.

How might recombinant LCL3 be utilized in diagnostic applications for invasive candidiasis?

Recombinant LCL3 has potential applications in the diagnosis of invasive candidiasis, particularly as an antigen for antibody detection. The development of such applications would follow this methodological approach:

Recombinant Antigen Production:

  • Express and purify full-length LCL3 or immunodominant fragments with high purity (>95%)

  • Validate proper folding through activity assays or structural analyses

  • Determine stability under storage conditions relevant for diagnostic reagents

Serological Assay Development:

  • Develop ELISA-based detection systems similar to those established for other C. albicans antigens like enolase and Hwp1

  • Optimize coating concentrations, blocking conditions, and detection parameters

  • Establish appropriate cut-off values through ROC curve analysis

Clinical Validation:
Based on similar studies with recombinant C. albicans antigens, clinical validation would require:

  • Testing sera from patients with proven invasive candidiasis (minimum 50-100 samples)

  • Including appropriate control groups:

    • Patients colonized with Candida but without invasion

    • Patients with invasive infections caused by other fungi

    • Healthy controls

  • Determination of sensitivity, specificity, positive and negative predictive values

Potential Performance Metrics:
Based on similar recombinant antigen-based tests for invasive candidiasis, target performance metrics might include:

  • Sensitivity: 70-90%

  • Specificity: 80-95%

  • Positive predictive value: >80%

  • Negative predictive value: >85%

These values are comparable to those reported for antibody detection against the recombinant N-terminal fragment of Hwp1 (88.9% sensitivity, 82.6% specificity) .

Species Cross-Reactivity Assessment:
Evaluate antibody detection in patients infected with non-C. albicans Candida species (C. parapsilosis, C. tropicalis, C. glabrata, etc.) to determine broad applicability of the diagnostic approach, similar to studies showing cross-reactivity with Hwp1 .

What are common challenges when working with recombinant nucleases like LCL3?

Recombinant production and characterization of nucleases present several technical challenges that researchers should anticipate:

Expression and Toxicity Issues:

  • Host toxicity: Active nucleases can degrade host DNA/RNA, resulting in growth inhibition or selection for inactive mutants. Solution: Use tight inducible promoters and co-express with nuclease inhibitors

  • Inclusion body formation: Misfolded nucleases often aggregate. Solution: Lower induction temperature (16-25°C), use solubility-enhancing fusion partners (MBP, SUMO)

  • Proteolytic degradation: Nucleases may be susceptible to proteolysis. Solution: Include protease inhibitors during purification, use protease-deficient expression strains

Purification Challenges:

  • Nucleic acid contamination: Nucleases often co-purify with bound nucleic acids. Solution: Include high salt washes (0.5-1M NaCl) during purification

  • Activity loss during purification: Nucleases may lose activity through oxidation or metal ion loss. Solution: Include reducing agents (DTT, β-mercaptoethanol) and appropriate metal ions

  • Self-cleavage: Active nucleases may degrade themselves. Solution: Maintain cold temperatures throughout purification, add EDTA during initial purification steps

Assay Interference:

  • Background nuclease activity: Sample contamination with environmental nucleases. Solution: Use nuclease-free reagents, include negative controls

  • Substrate selection: Different nucleases have varying specificities. Solution: Test multiple substrates (ssDNA, dsDNA, RNA) to determine LCL3 preference

  • Buffer optimization: Nuclease activity is highly dependent on salt concentration and pH. Solution: Perform buffer optimization screens

Storage Stability:

  • Activity loss during storage: Nucleases often lose activity rapidly. Solution: Add stabilizers (glycerol, BSA), store at -80°C in small aliquots

  • Freeze-thaw sensitivity: Repeated freeze-thaw cycles can denature proteins. Solution: Prepare single-use aliquots

Addressing these challenges requires systematic optimization and validation at each step of the experimental workflow.

How can activity and specificity of recombinant LCL3 be characterized?

Comprehensive characterization of recombinant LCL3 activity requires a methodical approach to determine substrate specificity, optimal reaction conditions, and kinetic parameters:

Substrate Specificity Analysis:

  • Test multiple nucleic acid substrates:

    • DNA substrates: ssDNA, dsDNA, supercoiled plasmid, linear DNA fragments

    • RNA substrates: total RNA, mRNA, structured RNA

    • Modified substrates: methylated DNA, phosphorothioate-modified DNA

  • Analytical methods:

    • Agarose gel electrophoresis for qualitative assessment

    • Fluorescence-based assays using labeled substrates for quantitative measurement

    • Circular dichroism to monitor structural changes in nucleic acid substrates

Reaction Condition Optimization:

  • pH dependency: Test activity across pH range 5.0-9.0 using appropriate buffers

  • Metal ion requirements: Screen divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺) at 1-10 mM

  • Salt sensitivity: Determine effect of monovalent ions (NaCl, KCl) from 0-500 mM

  • Temperature profile: Measure activity from 25-55°C to determine temperature optimum

Kinetic Parameter Determination:

  • Michaelis-Menten kinetics: Determine Km and kcat values using varying substrate concentrations

  • Inhibition studies: Test inhibition by nuclease inhibitors (EDTA, aurintricarboxylic acid)

  • Product analysis: Use mass spectrometry or sequencing to determine cleavage sites and sequence preferences

Structure-Function Analysis:

  • Generate site-directed mutants of conserved catalytic residues

  • Compare activity with homologous enzymes from related species

  • Perform limited proteolysis to identify stable domains

This comprehensive characterization would establish the biochemical properties of LCL3, providing insights into its biological function and potential applications in research or diagnostics.

How does LCL3 compare to other characterized nucleases in Candida species?

While LCL3 remains less characterized than other fungal nucleases, comparative analysis with better-studied nucleases can provide insights into its potential functions:

Comparison with Known Fungal Nucleases:

  • Extracellular nucleases in Candida species primarily function in biofilm formation, nutrient acquisition, and immune evasion

  • Unlike the well-characterized Nuc1p mitochondrial nuclease in S. cerevisiae, LCL3's cellular localization remains undefined

  • The Staphylococcal nuclease domain in LCL3 suggests potential functional similarities with bacterial extracellular nucleases that degrade neutrophil extracellular traps

Expression Pattern Distinctions:
The moderate expression level of LCL3 (FPKM 40.0, 60.3 percentile) suggests constitutive expression rather than stress-induced expression typical of some virulence-associated nucleases .

Evolutionary Conservation:
The significant conservation of LCL3 across various yeasts (46-56% identity) suggests a fundamental biological role rather than a species-specific virulence function, contrasting with rapidly evolving virulence factors .

What are promising research directions for understanding LCL3 function?

Future research on LCL3 should address knowledge gaps through multiple experimental approaches:

Systems Biology Approaches:

  • Transcriptomic analysis comparing wild-type and lcl3Δ/lcl3Δ mutants under different stress conditions

  • Proteomic identification of LCL3 interaction partners through immunoprecipitation and mass spectrometry

  • Metabolomic profiling to identify cellular processes affected by LCL3 deletion

Infection Model Studies:

  • Comparison of wild-type and lcl3Δ/lcl3Δ mutants in murine models of disseminated candidiasis

  • Ex vivo neutrophil interaction assays to assess potential roles in immune evasion

  • Biofilm formation assays to determine contribution to this virulence trait

Structural Biology:

  • X-ray crystallography or cryo-EM structure determination of LCL3

  • Computational modeling of substrate binding and catalytic mechanism

  • Structure-guided design of specific inhibitors

Translational Applications:

  • Evaluation as a biomarker for invasive candidiasis diagnostic development

  • Assessment as a potential drug target for antifungal development

  • Investigation as an immunogen for vaccine development

These research directions would provide comprehensive insights into LCL3 biology and potential applications in diagnosing and treating Candida infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.