Recombinant Candida albicans Solute carrier family 25 member 38 homolog (CaO19.1804)

What is the Candida albicans Solute carrier family 25 member 38 homolog (CaO19.1804)?

The Candida albicans Solute carrier family 25 member 38 homolog (CaO19.1804) is a protein belonging to the mitochondrial carrier family that facilitates the transport of metabolites, nucleotides, and cofactors across the inner mitochondrial membrane. This specific protein, identified in the C. albicans strain SC5314 / ATCC MYA-2876, has a UniProt accession number Q59KC4 and is encoded by the gene CaO19.1804 . Based on homology with human SLC25 family members, it likely plays a crucial role in connecting cytosolic and mitochondrial matrix functions by transporting essential cofactors such as Coenzyme A (CoA) .

How does the amino acid sequence of CaO19.1804 relate to its function?

The CaO19.1804 protein consists of 362 amino acids with a full sequence that begins with "MSSPPLSSPVPQVKTTQNGKSPDATVHLLAGAIAGLVSAVTLQPFDLLKTRLQQQQLTTK..." and continues as documented in the protein database . The sequence contains transmembrane domains characteristic of mitochondrial carriers, which form a channel across the inner mitochondrial membrane. These structural elements are critical for its function in metabolite transport. By analyzing the sequence homology with human SLC25A42, which transports CoA and adenosine 3′,5′-diphosphate, researchers can predict functional domains involved in substrate recognition and transport mechanism . Functional studies combining site-directed mutagenesis with transport assays would be necessary to confirm the specific amino acid residues essential for substrate binding and translocation.

What is the significance of studying C. albicans transporters in relation to pathogenicity?

Studying C. albicans transporters like CaO19.1804 is crucial because they represent potential targets for antifungal development due to their role in pathogen survival and virulence. C. albicans is the second most common agent of opportunistic fungal infection worldwide, causing both mucosal infections in healthy individuals and severe infections in immunocompromised patients . Mitochondrial carriers are essential for cellular metabolism and energy production, processes that underpin the pathogen's ability to colonize diverse host niches and resist host defense mechanisms. Understanding the transport mechanisms can reveal vulnerabilities in the pathogen's metabolic pathways that could be exploited therapeutically. Additionally, these proteins may contribute to drug resistance mechanisms or adaptation to different carbon sources within the host, making them valuable subjects for antifungal research .

What are the optimal conditions for expressing and purifying recombinant CaO19.1804?

For optimal expression and purification of recombinant CaO19.1804, researchers should consider the following methodology:

• Expression System: Use Escherichia coli C0214(DE3) strain for high-level expression, as this has been successful with similar mitochondrial carriers .

• Expression Conditions:

  • Culture bacteria in LB medium supplemented with appropriate antibiotics

  • Induce protein expression with IPTG (0.5-1 mM) when culture reaches OD600 of 0.6-0.8

  • Continue expression at 30°C for 4-5 hours to minimize inclusion body formation

• Purification Protocol:

  • Harvest cells by centrifugation and disrupt by sonication

  • Isolate inclusion bodies using sucrose density gradient centrifugation

  • Wash inclusion bodies with buffer containing Triton X-114 (3%, w/v), 1 mM EDTA, and 10 mM PIPES-KOH, pH 7.5

  • Follow with TE buffer (10 mM Tris-HCl, 1 mM EDTA, pH 8.0) washes

  • Solubilize the protein in 2% Sarkosyl (w/v)

  • Remove residual insoluble material by high-speed centrifugation (258,000 × g, 20 min)

• Reconstitution:

  • Dilute solubilized protein 11-fold with buffer containing Tris-HCl (10 mM, pH 8.0) and 0.6% Triton X-114

  • Reconstitute into liposomes by cyclic removal of detergent using hydrophobic columns of Amberlite beads

  • For functional studies, incorporate appropriate substrates in the reconstitution mixture

Storage recommendations include maintaining the purified protein at -20°C for routine use or -80°C for extended storage. Working aliquots can be stored at 4°C for up to one week to avoid repeated freeze-thaw cycles .

How can functional transport assays be designed to study CaO19.1804 activity?

To assess the transport activity of recombinant CaO19.1804, researchers should implement the following functional assay protocol:

• Proteoliposome Preparation:

  • Reconstitute purified CaO19.1804 into liposomes with a composition of approximately 90 μl of purified protein (15 μg), 70 μl of 10% Triton X-114, 90 μl of 10% phospholipids, 0.6 mg of cardiolipin, and substrate of interest (e.g., 10 mM ADP)

  • Remove external substrate using Sephadex G-75 columns pre-equilibrated with appropriate buffer

• Transport Measurement:

  • Implement the inhibitor-stop method at 25°C

  • Initiate transport by adding radiolabeled substrate (e.g., [³H]ADP or [¹⁴C]CoA)

  • Terminate transport at predetermined time points using specific inhibitors (e.g., bongkrekic acid)

  • Separate proteoliposomes by filtration or centrifugation

  • Measure radioactivity by liquid scintillation counting

• Kinetic Analysis:

  • Determine initial transport rates at various substrate concentrations

  • Calculate Km and Vmax values using Lineweaver-Burk or Eadie-Hofstee plots

  • Analyze substrate specificity by competition assays with unlabeled compounds

  • Assess inhibitor sensitivity to confirm transporter identity

• Data Validation:

  • Include control liposomes without protein

  • Perform time-course experiments to ensure measurement within linear range

  • Test influence of membrane potential and pH gradient

  • Validate results with multiple substrate concentrations

This methodology enables quantitative characterization of transport kinetics, substrate specificity, and inhibitor sensitivity, providing insights into the physiological role of CaO19.1804 in mitochondrial metabolism .

What techniques can be used to study the subcellular localization of CaO19.1804 in C. albicans?

To investigate the subcellular localization of CaO19.1804 in C. albicans, researchers should employ a multi-technique approach:

• Fluorescence Microscopy:

  • Generate C. albicans strains expressing CaO19.1804 fused to fluorescent proteins (GFP or mCherry)

  • Co-stain with organelle-specific dyes like MitoTracker for mitochondria

  • Perform live-cell imaging to observe dynamic localization

  • Use super-resolution microscopy for detailed subcellular distribution

• Subcellular Fractionation and Western Blot:

  • Prepare mitochondrial, cytosolic, and membrane fractions from C. albicans

  • Verify fraction purity using organelle-specific marker proteins

  • Detect CaO19.1804 in fractions using specific antibodies

  • Quantify relative distribution across compartments

• Immunogold Electron Microscopy:

  • Fix and embed C. albicans cells for ultrathin sectioning

  • Immunolabel with anti-CaO19.1804 antibodies and gold-conjugated secondary antibodies

  • Visualize precise localization within mitochondrial membranes

  • Perform quantitative analysis of gold particle distribution

• Protease Protection Assays:

  • Isolate intact mitochondria from C. albicans

  • Treat with proteases in the presence or absence of membrane-permeabilizing detergents

  • Analyze protease-resistant fragments by Western blot

  • Determine membrane topology of CaO19.1804

For optimal results, researchers should perform these analyses under different growth conditions (glucose vs. lactate media) as carbon source significantly affects C. albicans cell wall and potentially mitochondrial properties . This comprehensive approach will provide definitive evidence for the mitochondrial localization of CaO19.1804 and its precise orientation within the inner mitochondrial membrane.

How does carbon source adaptation affect CaO19.1804 expression and function in C. albicans?

Carbon source adaptation significantly impacts C. albicans metabolism and likely affects CaO19.1804 expression and function. To investigate this relationship:

• Expression Analysis:

  • Cultivate C. albicans in media with different carbon sources (glucose, lactate, glycerol)

  • Extract RNA and perform RT-qPCR targeting CaO19.1804

  • Alternatively, perform RNA-seq for genome-wide expression patterns

  • Compare expression levels across conditions and growth phases

• Proteomic Verification:

  • Generate C. albicans strains with epitope-tagged CaO19.1804

  • Grow in different carbon sources and prepare whole-cell lysates

  • Quantify protein levels by Western blot or mass spectrometry

  • Correlate protein abundance with transcript levels

• Functional Impact Assessment:

  • Prepare mitochondria from cells grown in different carbon sources

  • Measure transport activity using reconstituted proteoliposomes

  • Determine if substrate specificity or kinetic parameters change

  • Analyze mitochondrial metabolite profiles

Research shows that C. albicans grown in lactate exhibits altered cell wall composition, including reduced β-glucans and mannans, increased porosity, and differential sensitivity to stress agents compared to glucose-grown cells . These metabolic adaptations likely affect mitochondrial carrier proteins like CaO19.1804, potentially altering their expression, localization, or transport properties to accommodate different energy metabolism requirements. Such changes may influence the pathogen's ability to survive in diverse host niches and respond to antifungal challenges.

What is the role of CaO19.1804 in C. albicans stress response and virulence?

To determine CaO19.1804's role in stress response and virulence, researchers should implement a systematic approach:

• Gene Deletion and Phenotypic Analysis:

  • Generate CaO19.1804 knockout strains using CRISPR-Cas9 or traditional methods

  • Compare growth rates in standard and stress conditions (oxidative, osmotic, pH stress)

  • Test sensitivity to cell wall-perturbing agents (Congo Red, Calcofluor White, SDS)

  • Assess morphogenesis and filamentation capacity

• Virulence Assessment:

  • Perform adhesion and invasion assays with epithelial and endothelial cell lines

  • Evaluate biofilm formation capacity in vitro

  • Conduct macrophage killing/survival assays

  • Test virulence in appropriate animal models (e.g., mouse models of disseminated candidiasis)

• Metabolic Impact Analysis:

  • Compare metabolic profiles of wild-type and knockout strains

  • Assess mitochondrial function (oxygen consumption, membrane potential)

  • Measure CoA-dependent metabolic activities

  • Determine if virulence defects are linked to specific metabolic pathways

While direct evidence for CaO19.1804's role in virulence is not provided in the search results, research on C. albicans transcription factor RLM1 demonstrates how cell wall remodeling during carbon adaptation impacts interaction with immune cells . As a mitochondrial carrier, CaO19.1804 likely influences energy metabolism and potentially the synthesis of virulence factors. By facilitating CoA transport (if functionally similar to human SLC25A42), it would support fatty acid metabolism, acetylation reactions, and tricarboxylic acid cycle activity, all of which are essential for adapting to host environments and mounting stress responses .

How does CaO19.1804 function compare to its orthologs in other fungal pathogens and humans?

A comparative analysis of CaO19.1804 with its orthologs reveals important evolutionary and functional insights:

To investigate functional conservation and divergence:

• Phylogenetic Analysis:

  • Construct comprehensive phylogenetic trees of solute carrier family 25 members

  • Identify conserved domains and species-specific variations

  • Predict functional divergence based on selective pressure analysis

• Complementation Studies:

  • Express CaO19.1804 in S. cerevisiae or human cell lines lacking orthologous genes

  • Assess rescue of phenotypic defects

  • Determine if functional interchangeability exists between species

• Structural Comparison:

  • Generate homology models based on crystal structures of related transporters

  • Identify species-specific substrate binding pockets

  • Predict selectivity determinants for inhibitor design

• Selective Inhibition Potential:

  • Screen for compounds that selectively inhibit fungal orthologs over human counterparts

  • Test specificity using reconstituted proteoliposomes from different species

  • Validate in cellular systems

Human SLC25A42 serves as a mitochondrial transporter for CoA and adenosine 3′,5′-diphosphate, catalyzing counter-exchange transport with high affinity for these substrates . If CaO19.1804 shares this function, understanding structural and functional differences between the fungal and human proteins would be crucial for developing selective antifungals targeting this transport system while minimizing toxicity to human cells.

How can CRISPR-Cas9 technology be applied to study CaO19.1804 function in C. albicans?

CRISPR-Cas9 technology offers powerful approaches for investigating CaO19.1804 function in C. albicans:

• Gene Knockout Strategy:

  • Design guide RNAs targeting the CaO19.1804 coding sequence

  • Incorporate homology-directed repair templates with selectable markers

  • Transform C. albicans with CRISPR components using electroporation

  • Screen transformants by PCR and confirm by sequencing

  • Validate knockout at protein level by Western blot

• Conditional Expression Systems:

  • Implement doxycycline-regulated promoter replacement at the native locus

  • Design CRISPR-mediated homologous recombination strategy

  • Create strains with tunable CaO19.1804 expression

  • Validate conditional expression by RT-qPCR and Western blot

  • Determine phenotypic consequences of controlled depletion

• Domain-Specific Analysis:

  • Use CRISPR to introduce specific mutations in functional domains

  • Target conserved residues predicted to be involved in substrate binding

  • Generate point mutation libraries to identify critical amino acids

  • Assess functional consequences through growth and transport assays

• Reporter Fusion Strategy:

  • Design CRISPR-mediated C-terminal tagging with fluorescent proteins

  • Maintain native promoter to preserve physiological expression

  • Create multiplex reporters for co-localization studies

  • Analyze expression patterns and protein dynamics in living cells

This methodology enables precise genetic manipulation of CaO19.1804 in its native genomic context, allowing researchers to connect genotype to phenotype with high confidence. The approach has been successfully applied to study other C. albicans genes involved in cell wall remodeling and stress response , making it a robust strategy for functional characterization of mitochondrial transporters.

What interactions exist between CaO19.1804 and the cell wall integrity pathway in C. albicans?

Investigating interactions between CaO19.1804 and the cell wall integrity pathway requires integrative approaches:

• Double Mutation Analysis:

  • Generate strains with CaO19.1804 deletion combined with mutations in cell wall integrity pathway components (e.g., RLM1)

  • Compare phenotypes of single and double mutants under various stress conditions

  • Identify genetic interactions through epistasis analysis

  • Quantify synergistic or antagonistic effects on growth and stress resistance

• Transcriptional Network Mapping:

  • Perform RNA-seq comparing wild-type, CaO19.1804 deletion, and RLM1 deletion strains

  • Identify overlapping and distinct transcriptional responses

  • Analyze expression changes in genes related to mitochondrial function and cell wall biosynthesis

  • Validate key findings with RT-qPCR and reporter strains

• Metabolic Connectivity Assessment:

  • Implement metabolomics profiling focusing on intermediates connecting mitochondrial metabolism and cell wall precursors

  • Measure flow of carbon from different sources into cell wall components

  • Determine if CaO19.1804 deletion affects metabolic flux to cell wall biosynthesis

  • Correlate metabolic changes with alterations in cell wall composition

Research shows that RLM1, a transcription factor involved in cell wall remodeling during carbon adaptation, significantly impacts C. albicans sensitivity to cell wall-perturbing agents like Congo Red . Since mitochondrial metabolism provides energy and precursors for cell wall biosynthesis, CaO19.1804 may indirectly influence cell wall integrity through its role in metabolite transport. The carbon source profoundly affects cell wall properties, with lactate-grown cells showing altered sensitivity patterns compared to glucose-grown cells . These findings suggest potential metabolic connections between mitochondrial transporters and cell wall maintenance that warrant further investigation.

How can recombinant CaO19.1804 be utilized in the development of antifungal vaccines or therapeutics?

Leveraging recombinant CaO19.1804 for antifungal development presents several strategic approaches:

• Vaccine Development Pipeline:

  • Express and purify recombinant CaO19.1804 domains with potential immunogenicity

  • Formulate with appropriate adjuvants to enhance immune response

  • Evaluate antibody production and T-cell activation in animal models

  • Assess protective efficacy against C. albicans challenge

  • Determine cross-protection against multiple Candida species

• High-Throughput Inhibitor Screening:

  • Develop transport assays suitable for screening compound libraries

  • Implement fluorescence-based or radioactive substrate uptake measurements

  • Screen for selective inhibitors that target fungal but not human orthologs

  • Validate hits using secondary assays and structure-activity relationship studies

  • Assess in vitro antifungal activity against diverse Candida isolates

• Structure-Based Drug Design:

  • Generate high-resolution structural models of CaO19.1804

  • Identify unique binding pockets absent in human orthologs

  • Design small molecules targeting fungal-specific sites

  • Optimize lead compounds for improved selectivity and pharmacokinetics

  • Test efficacy in animal models of candidiasis

Previous research has demonstrated the success of recombinant protein-based vaccines against C. albicans. For example, a vaccine based on the recombinant N-terminal domain of Als1p (rAls1p-N) protected mice against disseminated candidiasis caused by multiple strains of C. albicans and non-C. albicans species . Similarly, recombinant CaO19.1804 or its immunogenic epitopes could potentially elicit protective immunity. As a mitochondrial carrier, CaO19.1804 represents a novel target class for antifungal development, potentially addressing the need for new therapeutic approaches against drug-resistant Candida infections.

What are the technical challenges in studying mitochondrial transporters in C. albicans?

Researchers face several significant technical challenges when investigating mitochondrial transporters in C. albicans:

• Mitochondrial Isolation Complexities:

  • C. albicans possesses a robust cell wall requiring specialized lysis conditions

  • Carbon source affects cell wall composition, necessitating adaptive protocols

  • Mitochondrial fragility during isolation can compromise functional studies

  • Solution: Optimize gentle cell disruption methods (enzymatic digestion followed by mechanical disruption) and include appropriate protease inhibitors

• Protein Expression Difficulties:

  • Codon usage bias between C. albicans and common expression hosts

  • Post-translational modifications may differ in heterologous systems

  • Membrane proteins often form inclusion bodies when overexpressed

  • Solution: Utilize codon-optimized constructs, test multiple expression hosts (including Pichia pastoris), and develop specialized refolding protocols

• Functional Reconstitution Challenges:

  • Maintaining native conformation during extraction and purification

  • Establishing appropriate lipid composition for proteoliposomes

  • Developing sensitive assays for transport activity measurement

  • Solution: Screen detergent/lipid combinations systematically and implement advanced analytical techniques like microscale thermophoresis for binding studies

• Genetic Manipulation Barriers:

  • C. albicans is diploid with a non-canonical genetic code

  • Limited availability of selectable markers for sequential modifications

  • Phenotypic consequences may be subtle or condition-dependent

  • Solution: Apply CRISPR-Cas9 systems optimized for Candida species and develop recyclable marker systems

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, and structural biology techniques tailored specifically for fungal systems .

How might changes in carbon metabolism affect CaO19.1804 function during C. albicans pathogenesis?

The impact of carbon metabolism on CaO19.1804 function during pathogenesis involves complex interactions:

• Metabolic Adaptation Mechanisms:

  • C. albicans encounters diverse carbon sources within host niches

  • Glucose-limited environments predominate in many infection sites

  • Alternative carbon utilization (lactate, amino acids, fatty acids) requires mitochondrial metabolism

  • CaO19.1804 may show differential expression and activity based on available carbon sources

• Host-Pathogen Interface Dynamics:

  • Carbon source affects cell wall composition and immunogenicity

  • Lactate-grown cells show altered β-glucan exposure affecting immune recognition

  • Mitochondrial transporters likely participate in metabolic reprogramming during phagocyte interactions

  • Immune cells may restrict access to specific carbon sources as defense mechanism

• Biofilm Metabolism Considerations:

  • Biofilms create microenvironments with carbon source gradients

  • Cells in different biofilm regions experience distinct metabolic demands

  • CaO19.1804 function may vary across biofilm architecture

  • Metabolic flexibility contributes to biofilm persistence and drug resistance

Research demonstrates that carbon source significantly impacts C. albicans cell wall structure, with lactate-grown cells showing thinner cell walls, reduced β-glucans and mannans, and increased porosity compared to glucose-grown cells . These adaptations influence interactions with the host immune system and sensitivity to antifungal drugs. As a putative mitochondrial CoA transporter, CaO19.1804 would play a crucial role in supporting the metabolic flexibility required for adaptation to diverse host environments during the infection process.

What emerging technologies could advance our understanding of CaO19.1804 and related transporters?

Several cutting-edge technologies show promise for advancing research on CaO19.1804 and related transporters:

• Cryo-Electron Microscopy:

  • Enables high-resolution structural determination without crystallization

  • Captures transporters in different conformational states

  • Reveals substrate binding sites and conformational changes

  • Supports structure-based drug design targeting fungal-specific features

• Single-Cell RNA Sequencing:

  • Characterizes expression heterogeneity within C. albicans populations

  • Identifies subpopulations with distinct transporter expression patterns

  • Maps transcriptional responses to environmental changes at single-cell resolution

  • Reveals coordination between mitochondrial transporters and virulence factors

• Genome-Wide CRISPR Screens:

  • Identifies genetic interactions with CaO19.1804

  • Uncovers synthetic lethal relationships with potential therapeutic implications

  • Maps functional connections to stress response and virulence pathways

  • Enables systematic phenotypic analysis under diverse conditions

• Metabolic Flux Analysis:

  • Quantifies metabolite flow through pathways connected to mitochondrial transport

  • Measures impact of CaO19.1804 deletion on central carbon metabolism

  • Identifies metabolic bottlenecks and compensatory mechanisms

  • Connects transport function to broader metabolic networks

• Organoid Infection Models:

  • Provides physiologically relevant tissue environments

  • Enables study of CaO19.1804 function during host-pathogen interactions

  • Supports long-term infection dynamics investigation

  • Bridges gap between in vitro studies and animal models

Integration of these advanced technologies with established biochemical and genetic approaches will provide a comprehensive understanding of CaO19.1804's role in C. albicans biology and pathogenesis, potentially revealing new avenues for therapeutic intervention against this important fungal pathogen .