Recombinant Candida albicans Squalene monooxygenase (ERG1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Candida albicans Squalene Monooxygenase (ERG1)

Recombinant Candida albicans Squalene monooxygenase, encoded by the ERG1 gene, is a crucial enzyme in the biosynthesis of ergosterol, a vital component of fungal cell membranes. This enzyme catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, a key step in the ergosterol biosynthesis pathway . Ergosterol is essential for maintaining membrane integrity, fluidity, and permeability, as well as for cell growth and morphogenesis .

Function and Importance of ERG1

ERG1 is a FAD-containing mixed-function oxygenase that requires a yet unidentified reductase activity for its function . The enzyme is localized in both the endoplasmic reticulum and lipid particles within the cell, although its enzymatic activity is primarily detectable in the endoplasmic reticulum . The dual localization suggests a complex interaction between these cellular compartments in sterol biosynthesis.

ERG1 FunctionImportance
Catalyzes squalene to (S)-2,3-epoxysqualeneEssential for ergosterol biosynthesis
Localized in ER and lipid particlesSuggests interaction between ER and lipid particles in sterol synthesis
Target of allylamine antifungals (e.g., terbinafine)Important for antifungal drug development

Research Findings on ERG1 Mutants

Studies on ERG1 mutants have shown that disrupting both alleles of the ERG1 gene in Candida albicans is lethal, indicating the critical role of this enzyme in cell viability . Conditional mutants, where the second allele is under a regulable promoter, exhibit a lack of ergosterol and accumulation of squalene, leading to defects in growth and increased susceptibility to antifungal drugs . These mutants also show impaired morphogenesis, as they are unable to form hyphae, which are important for the pathogenicity of Candida albicans .

ERG1 Mutant PhenotypeEffect
Lack of ergosterol, accumulation of squaleneDefects in growth, increased drug susceptibility
Impaired morphogenesisUnable to form hyphae
Reduced drug efflux activityEnhanced passive diffusion, reduced efflux by ABC transporters

Antifungal Drug Targeting ERG1

ERG1 is targeted by allylamine antifungals like terbinafine, which inhibit the enzyme's activity noncompetitively . This inhibition disrupts ergosterol biosynthesis, leading to cell death. The enzyme's role as a drug target highlights its significance in the development of antifungal therapies.

Antifungal DrugMechanism of Action
TerbinafineNoncompetitive inhibition of ERG1
Other allylaminesSimilar mechanism, disrupting ergosterol biosynthesis

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ERG1; CAALFM_C108590CA; CaO19.406; CaO19.8036; Squalene monooxygenase; Squalene epoxidase; SE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-496
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
ERG1
Target Protein Sequence
MSSVKYDAIIIGAGVIGPTIATAFARQGRKVLIVERDWSKPDRIVGELMQPAGIKALREL GMIKAINNIRAVDCTGYYIKYYDETITIPYPLKKDACITNPVKPVPDAVDGVNDKLDSDS TLNVDDWDFDERVRGAAFHHGDFLMNLRQICRDEPNVTAVEATVTKILRDPSDPNTVIGV QTKQPSGTVDYHAKLTISCDGIYSKFRKELSPTNVPTIGSYFIGLYLKNAELPAKGKGHV LLGGHAPALIYSVSPTETRVLCVYVSSKPPSAANDAVYKYLRDNILPAIPKETVPAFKEA LEERKFRIMPNQYLSAMKQGSENHKGFILLGDSLNMRHPLTGGGMTVGLNDSVLLAKLLH PKFVEDFDDHQLIAKRLKTFHRKRKNLDAVINTLSISLYSLFAADKKPLRILRNGCFKYF QRGGECVNGPIGLLSGMLPFPMLLFNHFFSVAFYSVYLNFIERGLLGFPLALFEAFEVLF TAIVIFTPYLWNEIVR
Uniprot No.

Target Background

Function
Recombinant *Candida albicans* Squalene monooxygenase (ERG1) catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene. This enzyme is considered rate-limiting in steroid biosynthesis.
Database Links
Protein Families
Squalene monooxygenase family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Squalene Monooxygenase (ERG1) and what is its role in Candida albicans?

Squalene Monooxygenase (ERG1) is an essential enzyme in the ergosterol biosynthesis pathway in fungi, including Candida albicans. It catalyzes the first oxygenation step, converting squalene to 2,3-oxidosqualene, which is a critical precursor for ergosterol production. Ergosterol serves as the fungal equivalent of cholesterol in mammalian cells, maintaining membrane fluidity and integrity.

In C. albicans, ERG1 is particularly important because ergosterol biosynthesis is necessary for hyphal morphogenesis, which contributes to virulence. As observed with other proteins in C. albicans, morphological transitions can trigger differential expression patterns of genes involved in cell wall and membrane integrity . The ERG1 gene is constitutively expressed in both yeast and hyphal forms, though expression levels may vary depending on growth conditions and exposure to environmental stressors.

How does ERG1 differ from EGR1 in host-pathogen interactions?

It's important to distinguish between ERG1 (fungal Squalene Monooxygenase) and EGR1 (host Early Growth Response protein 1). ERG1 is a fungal enzyme involved in ergosterol biosynthesis, while EGR1 is a transcription factor in human cells that regulates various genes in response to external stimuli, including pathogen recognition.

Recent research demonstrates that EGR1 expression increases in oral epithelial cells (OECs) when exposed to C. albicans, independent of fungal viability, morphology, or candidalysin release . This suggests EGR1 plays a role in the fundamental recognition of C. albicans rather than specifically responding to invasion or pathogenesis. In contrast, ERG1 in C. albicans contributes to the pathogen's ability to establish and maintain infection by ensuring proper membrane structure and function.

What are the optimal expression systems for recombinant C. albicans ERG1?

For recombinant expression of C. albicans ERG1, researchers typically employ eukaryotic expression systems due to the enzyme's membrane-associated nature and post-translational modifications. The following systems have demonstrated effectiveness:

  • Saccharomyces cerevisiae expression system: This closely related yeast offers similar protein processing machinery and membrane composition.

  • Pichia pastoris expression system: Beneficial for high-yield production of membrane proteins.

  • Baculovirus-insect cell expression system: Provides robust expression with proper folding for complex eukaryotic proteins.

When designing expression constructs, researchers should consider incorporating:

  • N-terminal or C-terminal affinity tags (His6, GST, or FLAG) for purification

  • Codon optimization for the host organism

  • Signal sequences for proper membrane targeting

  • Inducible promoters for controlled expression

What challenges exist in purifying active recombinant ERG1 and how can they be addressed?

Purification of active recombinant ERG1 presents several challenges:

Table 1: Challenges in ERG1 Purification and Mitigation Strategies

ChallengeDescriptionMitigation Strategy
Membrane associationERG1 contains transmembrane domainsUse detergents (DDM, CHAPS, or Triton X-100) for solubilization
Protein stabilityERG1 may lose activity during purificationInclude glycerol (10-20%) and reducing agents in buffers
Host contaminationEndogenous proteins may co-purifyMulti-step purification protocol with orthogonal techniques
Low expression yieldsMembrane proteins often express poorlyOptimize induction conditions and consider fusion partners
Post-translational modificationsRequired for full activityUse eukaryotic expression systems

A typical purification protocol includes:

  • Cell lysis using mechanical disruption

  • Membrane fraction isolation through differential centrifugation

  • Detergent solubilization (typically 1% DDM)

  • Affinity chromatography using the attached tag

  • Ion exchange chromatography for increased purity

  • Size exclusion chromatography as a final polishing step

Maintaining the native lipid environment is critical for ERG1 activity, so some researchers employ nanodiscs or liposome reconstitution after purification.

What are the most reliable methods to measure recombinant ERG1 activity?

Several complementary approaches can be used to assess ERG1 activity:

  • Spectrophotometric NADPH consumption assay: Measures the rate of NADPH oxidation at 340 nm, as ERG1 requires NADPH as a cofactor.

  • Radiolabeled substrate assay: Utilizes 14C-labeled squalene to track conversion to 2,3-oxidosqualene. Products are separated by thin-layer chromatography and quantified by scintillation counting.

  • LC-MS/MS analysis: Provides sensitive detection of substrate depletion and product formation without radiolabeling.

  • Oxygen consumption measurement: Using an oxygen electrode to monitor the incorporation of oxygen during the reaction.

Table 2: Comparison of ERG1 Activity Assay Methods

Assay MethodSensitivityThroughputEquipment NeedsAdvantagesLimitations
NADPH consumptionModerateHighSpectrophotometerSimple, real-timeIndirect, potential interference
Radiolabeled substrateHighLowTLC, scintillation counterDirect product detectionRequires radioactive materials
LC-MS/MSVery highModerateLC-MS/MS systemDirect, no radioactivityExpensive equipment
Oxygen consumptionModerateLowOxygen electrodeDirect measurementLower throughput

When establishing these assays, researchers should control for potential interferences from the expression system and purification process that might affect enzyme activity.

How can site-directed mutagenesis be used to study ERG1 structure-function relationships?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in recombinant ERG1. Key aspects include:

  • Target selection: Focus on conserved residues identified through sequence alignment with homologous proteins or predicted catalytic sites.

  • Mutation types:

    • Conservative substitutions to probe subtle functional requirements

    • Alanine scanning to identify essential residues

    • Introduction of cysteine residues for accessibility studies

  • Functional analysis: Compare wild-type and mutant proteins for:

    • Kinetic parameters (Km, Vmax, kcat)

    • Substrate specificity

    • Inhibitor sensitivity

    • Protein stability and folding

  • Structural implications: Correlate functional changes with structural features using computational modeling or, ideally, experimental structure determination.

Similar approaches have been used to study signaling pathways in C. albicans, such as the investigation of Ire1 protein kinase, which showed pleiotropic roles in stress response, antifungal tolerance, and regulation of virulence-related traits .

How does ERG1 contribute to antifungal resistance in C. albicans?

ERG1 plays a significant role in antifungal resistance through several mechanisms:

  • Target of allylamines: Terbinafine and other allylamines directly inhibit ERG1, disrupting ergosterol biosynthesis. Mutations in ERG1 can confer resistance to these antifungals.

  • Indirect role in azole resistance: While azoles target Erg11 (lanosterol 14α-demethylase), alterations in ERG1 expression or activity can compensate for ergosterol depletion, contributing to azole resistance.

  • Stress response integration: Similar to other ER-resident proteins in C. albicans, such as Ire1, ERG1 function may be integrated with cellular stress responses that contribute to antifungal tolerance .

  • Biofilm formation: ERG1 is necessary for proper membrane composition, which affects C. albicans biofilm formation and the resulting increased resistance to antifungals.

What approaches can be used to design and screen ERG1 inhibitors?

Designing and screening ERG1 inhibitors involves multiple complementary approaches:

  • Structure-based design:

    • Homology modeling of C. albicans ERG1 based on crystallized homologs

    • Virtual screening of compound libraries against the active site

    • Fragment-based drug design to develop novel scaffolds

  • High-throughput screening (HTS) methods:

    • Biochemical assays using purified recombinant ERG1

    • Cell-based assays measuring ergosterol production

    • Phenotypic screening for antifungal activity

  • Medicinal chemistry optimization:

    • Structure-activity relationship studies

    • ADME (absorption, distribution, metabolism, excretion) property improvement

    • Selectivity enhancement over human homologs

  • Validation approaches:

    • Target engagement studies (thermal shift assays, competition binding)

    • Resistance development analysis

    • Combination studies with existing antifungals

When developing ERG1 inhibitors, researchers should consider how they might affect signaling pathways in C. albicans. Recent research on host-pathogen interactions shows that C. albicans activates EGFR-MAPK signaling pathways in epithelial cells , and disruption of fungal membrane composition through ERG1 inhibition could potentially alter these interaction dynamics.

How can recombinant ERG1 be used to study host-pathogen interactions?

Recombinant ERG1 provides multiple avenues for investigating host-pathogen interactions:

  • Immune recognition studies: ERG1, as an essential fungal protein, may generate fungal-specific epitopes that can be recognized by the host immune system. Researchers can use purified recombinant ERG1 to:

    • Identify antibody responses in infected hosts

    • Characterize T-cell epitopes

    • Investigate pattern recognition receptor interactions

  • Interactome mapping: Using techniques such as co-immunoprecipitation and proximity labeling with recombinant ERG1 to identify host proteins that interact with fungal components during infection.

  • Ergosterol pathway manipulation: Modulating ERG1 function in C. albicans to investigate how alterations in cell membrane composition affect:

    • Recognition by host cells

    • Candidalysin toxin release and function

    • Activation of host defense mechanisms

Recent research has shown that oral epithelial cells respond to C. albicans through EGR1 upregulation, which is mediated by EGFR via Raf1, ERK1/2, and NF-κB signaling . While this host response occurs independently of fungal viability or morphology, alterations in fungal ERG1 function could potentially influence these host recognition patterns through changes in cell wall composition and exposure of pathogen-associated molecular patterns (PAMPs).

How does ERG1 expression and function change during different stages of C. albicans infection?

ERG1 expression and function are dynamically regulated throughout C. albicans infection:

Table 3: ERG1 Regulation During Infection Stages

Infection StageERG1 Expression/FunctionBiological Significance
ColonizationBaseline expressionMaintenance of membrane integrity during commensal growth
AdhesionPotential upregulationFacilitates proper cell surface interactions with host
Hyphal formationIncreased expressionSupports membrane reorganization during morphogenesis
Biofilm formationHigh expressionEssential for extracellular matrix production and drug resistance
Invasive growthDynamic regulationAdaptation to varying tissue environments
Response to antifungalsCompensatory upregulationResistance mechanism to maintain ergosterol levels

To study these changes, researchers can employ:

  • Transcriptional profiling: RNA-seq or qPCR to measure ERG1 expression changes during infection progression.

  • Reporter strains: GFP-tagged ERG1 to visualize expression patterns in different infection models.

  • Conditional mutants: Regulatable ERG1 expression to determine the requirement for ERG1 at specific infection stages.

  • Metabolomic analysis: Measuring ergosterol and pathway intermediates to assess ERG1 function in vivo.

Similar to other C. albicans proteins involved in stress responses, such as Ire1 , ERG1 likely has pleiotropic roles that extend beyond ergosterol biosynthesis and may impact multiple virulence-related traits throughout the infection process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.