Recombinant Candida albicans Squalene synthase (ERG9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERG9; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Candida albicans (Yeast)
Target Names
ERG9
Target Protein Sequence
MGKFLQLLSHPTELKAVIQLFGFRQPLHPGKRDVNDKELGRCYELLNLTSRSFAAVIEEL HPELRDAVMIFYLVLRALDTIEDDMTIKSSIKIPLLREFDTKLNTKNWTFDGYGPNEKDR TVLVEFDKILNVYHRLKPQYQDIIKSITFKMGNGMADYILDEEFNVYGVATVEDYNLYCH YVAGLVGEGLTNLFVLANFGDKTLTENNFAKADSMGLFLQKTNIIRDYHEDLQDGRSFWP REIWSKYTENLQDFHKVKTPAKEFAGVSCINELVLNALGHVTDCLDYLSLVKDPSSFSFC AIPQVMAVATLAEVYNNPKVLHGVVKIRKGTTCRLILESRTLPGVVKIFKEYIQVINHKS SVRDPNYLKIGIKCGEIEQYCEMIYPNKQALPPSMKSLPENKFTKIVASRESIDLSVQRR IEPGNFNCNVVLFGIGALILSLIYFVLY
Uniprot No.

Target Background

Function
Recombinant *Candida albicans* Squalene Synthase (ERG9) catalyzes the condensation of two farnesyl pyrophosphate molecules to form squalene, the first committed step in sterol biosynthesis. It is essential for ergosterol biosynthesis.
Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the role of ERG9 in Candida albicans sterol biosynthesis?

Squalene synthase (encoded by ERG9) catalyzes the first committed step in the sterol biosynthesis pathway in fungi, converting farnesyl diphosphate (FPP) to squalene via a two-step reaction that proceeds through the presqualene diphosphate intermediate. This conversion requires the presence of Mg²⁺ and NADPH as cofactors. As demonstrated in studies with other yeasts, this enzymatic step represents the branching point where carbon flux is directed specifically toward sterol biosynthesis rather than other isoprenoid pathways, making it a crucial regulatory point in ergosterol production . Unlike downstream enzymes that may affect multiple pathways, ERG9 specifically impacts sterol biosynthesis, allowing for more precise genetic and biochemical manipulations in research contexts.

How conserved is ERG9 across Candida species and other fungi?

ERG9 is highly conserved across fungal species, reflecting its essential role in sterol biosynthesis. Sequence analysis reveals significant homology between Candida albicans ERG9 and its orthologs in other species. Specifically, C. glabrata ERG9 shares 71.3% amino acid sequence identity with Saccharomyces cerevisiae Erg9p and approximately 53.1% identity with other fungal species . This conservation extends to key functional domains and catalytic residues essential for enzymatic activity. Multiple sequence alignments using degenerate primers designed from conserved regions of squalene synthase from S. cerevisiae, C. albicans, Schizosaccharomyces pombe, Arabidopsis thaliana, and human sequences have successfully amplified ERG9 homologs, demonstrating the evolutionary conservation of critical regions . This high degree of conservation facilitates comparative studies and the application of findings from model organisms to pathogenic Candida species.

What are the essential domains and functional residues in recombinant C. albicans ERG9?

Recombinant C. albicans ERG9, like its homologs in other fungi, contains several essential functional domains that are critical for its enzymatic activity:

  • The catalytic domain containing conserved residues responsible for substrate binding and catalysis

  • NADPH binding sites essential for the reductive step in squalene formation

  • Mg²⁺ coordination sites that facilitate proper substrate orientation

  • A C-terminal hydrophobic domain that mediates membrane association

Research with S. cerevisiae has shown that modification of the structural gene to remove the hydrophobic C-terminal domain results in a soluble truncated protein that retains catalytic activity . This truncated form catalyzes the conversion of FPP to squalene via presqualene diphosphate with measurable kinetic parameters. In recombinant expression systems, the truncated enzyme is typically more soluble and constitutes approximately 2-5% of total cellular protein when expressed in E. coli . Functional studies indicate that key catalytic parameters include an FPP concentration of approximately 40 μM for half-maximal activity, with FPP becoming inhibitory at higher concentrations, and optimal activity observed at kcat = 3.3 s⁻¹ at 100 μM FPP in the presence of 1% (v/v) Tween 80 .

What are the optimal expression systems for recombinant C. albicans ERG9?

For expressing recombinant C. albicans ERG9, researchers have successfully employed both prokaryotic (E. coli) and eukaryotic (yeast) expression systems, each with distinct advantages for different research applications:

E. coli Expression System:
The E. coli expression system offers high protein yields and simplified purification processes. Based on protocols established for S. cerevisiae squalene synthase, a modified approach for C. albicans ERG9 typically involves:

  • PCR modification of the structural gene to remove the hydrophobic C-terminal domain

  • Cloning the truncated open reading frame into an appropriate E. coli expression vector

  • Expression typically results in soluble protein constituting 2-5% of total cellular protein

  • The recombinant enzyme can be purified to >95% homogeneity using a two-step chromatography process involving hydroxyapatite and phenyl-Superose

Yeast Expression System:
For studies requiring post-translational modifications or when investigating regulatory mechanisms, yeast expression systems provide a more native-like environment:

  • The ERG9 gene can be placed under control of regulatable promoters (such as tetracycline-regulatable promoters used in C. glabrata studies)

  • This approach allows for controlled expression and depletion studies

  • The enzyme retains native membrane association when expressed with its full C-terminal domain

The choice between these systems depends on the research objectives, with E. coli being preferable for structural and biochemical studies requiring large amounts of purified protein, while yeast systems are advantageous for functional and regulatory studies in a more physiologically relevant context.

What is the optimal protocol for purifying active recombinant C. albicans ERG9?

Based on established protocols for homologous enzymes, purification of active recombinant C. albicans ERG9 typically follows this optimized procedure:

  • Truncation of C-terminal domain: PCR modification to remove the hydrophobic C-terminal domain (approximately 24 amino acids) to enhance solubility while maintaining catalytic activity

  • Cell lysis conditions:

    • Buffer composition: 50 mM potassium phosphate (pH 7.4), 1 mM EDTA, 5 mM DTT

    • Addition of protease inhibitors (PMSF, leupeptin, pepstatin)

    • Gentle lysis via sonication or French press to preserve enzyme activity

  • Chromatographic purification:

    • Step 1: Hydroxyapatite chromatography with elution using phosphate gradient (50-300 mM)

    • Step 2: Phenyl-Superose hydrophobic interaction chromatography with decreasing ammonium sulfate gradient

    • This two-step process typically yields protein of >95% homogeneity

  • Activity preservation:

    • Addition of detergents (1% v/v Tween 80) significantly enhances enzyme activity

    • Storage buffer should contain 10% glycerol, 1 mM DTT to maintain stability

    • Enzyme activity is optimal in the presence of Mg²⁺ (5-10 mM) and NADPH (0.5-1 mM)

The resulting purified enzyme is typically monomeric and capable of catalyzing the two-step conversion of FPP to squalene. Activity assays should be performed immediately after purification for optimal results, as prolonged storage may result in decreased catalytic efficiency.

How can enzymatic activity of purified recombinant ERG9 be reliably measured?

Standard enzymatic assays for measuring recombinant C. albicans ERG9 activity utilize either radioactive substrate tracking or product detection methodologies:

Radioactive Substrate Assay:

  • Incubate purified enzyme (1-5 μg) with 40-100 μM [¹⁴C]FPP substrate

  • Reaction buffer: 50 mM potassium phosphate (pH 7.4), 5 mM MgCl₂, 1 mM NADPH

  • Optional addition of 1% (v/v) Tween 80 to enhance activity

  • Incubate at 30°C for 20-30 minutes

  • Terminate reaction with KOH/methanol and extract products with hexane

  • Analyze conversion via thin-layer chromatography and scintillation counting

Product Detection Assay:

  • Utilize HPLC or GC-MS methods to quantify squalene production

  • Reaction conditions similar to radioactive assay but with non-labeled FPP

  • Extract reaction products and analyze against squalene standards

Kinetic Parameters Determination:
For accurate kinetic characterization, the assay should be performed with varying substrate concentrations (10-200 μM FPP). The enzyme exhibits typical Michaelis-Menten kinetics with an FPP concentration of approximately 40 μM needed for half-maximal activity. At higher concentrations, FPP becomes inhibitory. Maximum activity (kcat = 3.3 s⁻¹) is typically observed at 100 μM FPP in the presence of detergent .

Table 1: Typical Squalene Synthase Activity Parameters

ParameterWild-type valueNotes
Km for FPP~40 μMHigher concentrations inhibitory
kcat3.3 s⁻¹In presence of 1% Tween 80
Optimal pH7.2-7.4In potassium phosphate buffer
Mg²⁺ requirement5-10 mMEssential cofactor
NADPH requirement0.5-1 mMRequired for second step of reaction

The activity assay can be adapted to evaluate potential inhibitors by including test compounds in the reaction mixture and determining IC₅₀ values through dose-response curves.

How is ERG9 transcriptionally regulated in Candida species?

The transcriptional regulation of ERG9 in Candida species involves multiple mechanisms that respond to cellular sterol levels, growth conditions, and environmental stressors:

Sterol-Responsive Elements:
ERG9 expression is tightly regulated by intracellular sterol levels through sterol regulatory elements (SREs) in its promoter region. By analogy with S. cerevisiae, C. albicans ERG9 is likely regulated by transcription factors binding to these elements, with expression decreasing when sterols are abundant and increasing during sterol depletion . This negative feedback mechanism helps maintain appropriate ergosterol levels within the cell.

Carbon Source Dependent Regulation:
Transcription of ERG9 and related ergosterol biosynthesis genes is modulated by carbon source availability. Studies in related Candida species have shown that transcriptional responses to antifungal drugs can be significantly altered depending on the carbon source utilized by the cells . This metabolic regulation suggests integration between central carbon metabolism and sterol biosynthesis pathways.

Growth Phase Regulation:
Expression levels of ERG9 vary throughout different growth phases (logarithmic, diauxic, and stationary phases), as observed with other sterol biosynthesis genes in C. albicans . Typically, expression is highest during active growth (logarithmic phase) when membrane synthesis and ergosterol requirements are elevated.

Stress Response Regulation:
Oxidative stress significantly impacts ERG9 regulation. Fission yeast studies have demonstrated that ergosterol levels are repressed during oxidative stress through mechanisms independent of the standard SCF (Skp1-Cullin-F-box) pathway , suggesting multiple regulatory inputs control ERG9 expression under different stress conditions.

When investigating transcriptional regulation, nuclear run-on analyses can be employed to determine if increased mRNA levels result from enhanced transcription rather than post-transcriptional mechanisms, as has been done for other genes involved in antifungal resistance in C. albicans .

What regulatory elements control C. albicans ERG9 expression in different environmental conditions?

Several key regulatory elements and mechanisms control C. albicans ERG9 expression across varying environmental conditions:

Promoter Elements:
The ERG9 promoter region contains multiple regulatory elements, including:

  • Sterol Regulatory Elements (SREs) that respond to cellular sterol levels

  • Oxygen-responsive elements that modulate expression under aerobic vs. anaerobic conditions

  • General stress response elements that respond to various cellular stresses

Serum Response:
A particularly significant regulatory mechanism is the serum response. When C. albicans (or related species like C. glabrata) is exposed to serum, ERG9 activity is significantly decreased . This repression occurs through both transcriptional and post-translational mechanisms:

  • Transcriptionally: The presence of exogenous sterols (cholesterol) from serum leads to downregulation of ERG9 transcription

  • Post-translationally: Squalene synthase activity decreases even when the gene is expressed from artificial promoters not subject to normal transcriptional regulation

This dual regulation explains why ERG9-deficient fungal cells can survive in serum-containing media or in vivo environments where host cholesterol is available . The ability to downregulate ERG9 in response to exogenous sterols represents a sophisticated regulatory mechanism that allows Candida species to conserve energy by reducing endogenous sterol synthesis when external sources are available.

Table 2: ERG9 Activity Under Different Growth Conditions

Growth ConditionRelative ERG9 ActivityRegulatory Mechanism
Laboratory media (no serum)100%Baseline activity
Serum-containing media10-20%Transcriptional and post-translational repression
DOX treatment (ERG9 under tet-regulatable promoter)<5%Artificial repression
In vivo (mouse model)10-25%Primarily post-translational regulation

These regulatory mechanisms have important implications for antifungal drug development, as they suggest that inhibitors targeting squalene synthase may have limited efficacy in vivo where fungi can utilize host sterols .

How does ERG9 expression relate to antifungal drug resistance mechanisms in C. albicans?

The relationship between ERG9 expression and antifungal drug resistance in C. albicans involves complex regulatory networks affecting the entire ergosterol biosynthesis pathway:

Azole Resistance Mechanisms:
While ERG9 itself is not the primary target of azole antifungals (which typically target ERG11/lanosterol 14-alpha-demethylase), its regulation is often altered in resistant strains as part of global changes to the ergosterol pathway. Azole-resistant strains of C. albicans frequently display altered expression of multiple ergosterol biosynthesis genes, including ERG9, as part of compensatory mechanisms to maintain membrane integrity and function .

Coordinate Regulation with Efflux Pumps:
ERG9 expression changes often coincide with alterations in drug efflux pump genes such as CDR and MDR1. Transcriptional analyses of antifungal drug resistance in C. albicans have revealed that resistant isolates frequently show coordinate upregulation of these genes along with ergosterol pathway components . This coordinate regulation suggests common transcriptional control mechanisms responding to antifungal pressure.

Growth Phase Dependence:
The expression of ERG9 and its relationship to drug resistance varies with growth phase. Studies monitoring ERG11, CDR, and MDR1 mRNA levels throughout different growth phases (logarithmic, diauxic, and stationary) have demonstrated that the expression patterns of these genes can differ significantly between susceptible and resistant isolates . Similar growth phase-dependent patterns likely exist for ERG9.

Carbon Source Effects:
The carbon source significantly impacts the expression of genes involved in antifungal resistance. As demonstrated with other ergosterol pathway genes, ERG9 expression and its contribution to resistance phenotypes may vary substantially depending on whether cells are grown with glucose, glycerol, or other carbon sources . This environmental responsiveness adds another layer of complexity to understanding resistance mechanisms.

These findings underscore the importance of considering growth conditions, cellular environment, and regulatory networks when studying ERG9's role in antifungal resistance. Researchers should design experiments that account for these variables to accurately characterize the contribution of ERG9 to resistance phenotypes.

Is ERG9 essential for C. albicans survival and virulence in vivo?

The essentiality of ERG9 for C. albicans survival and virulence presents a nuanced picture that differs between in vitro and in vivo conditions:

In Laboratory Media:
In standard laboratory media, ERG9 function is essential for cell viability. Studies with the related species C. glabrata demonstrated that depletion of ERG9 using a tetracycline-regulatable promoter system resulted in severe growth defects and rapid cell death (within 5 hours after ERG9 depletion) . This indicates that de novo synthesis of ergosterol through the squalene synthase pathway is critical for survival in standard growth conditions.

In Serum-Containing Media:
Interestingly, the growth defect caused by ERG9 depletion in laboratory media can be suppressed by the addition of serum . Analysis of sterol composition revealed that C. glabrata cells could incorporate exogenous cholesterol from serum to complement the defect in ergosterol biosynthesis. This demonstrates a remarkable metabolic flexibility that allows cells to utilize host sterols when endogenous synthesis is compromised.

In Animal Models:
The most striking finding comes from in vivo studies using mouse models. Despite the essentiality of ERG9 in laboratory media, depletion of the gene did not affect fungal growth in mice at all . C. glabrata cells with depleted ERG9 were able to proliferate normally in mice treated with doxycycline (to repress ERG9 expression), with growth patterns comparable to wild-type cells. This surprising result indicates that the ability to incorporate host cholesterol fully compensates for the loss of endogenous ergosterol synthesis in vivo.

Implications for Virulence:
These findings suggest that while ergosterol itself is essential for Candida virulence, the specific route of acquisition (de novo synthesis vs. host uptake) is flexible. This metabolic adaptability represents an important virulence mechanism that allows Candida species to maintain membrane integrity and function even when specific biosynthetic pathways are inhibited, either genetically or pharmacologically.

The ability of Candida species to utilize host sterols has significant implications for antifungal drug development, suggesting that inhibitors targeting squalene synthase may have limited efficacy in treating infections despite showing strong activity in vitro .

How does recombinant ERG9 expression affect sterol composition and membrane properties?

Modulation of recombinant ERG9 expression significantly impacts cellular sterol composition and membrane properties in Candida species, with cascading effects on cellular physiology:

Sterol Composition Changes:
When ERG9 expression is altered (either upregulated in recombinant systems or downregulated in depletion studies), the sterol composition of the cell undergoes significant changes:

  • ERG9 depletion in laboratory media leads to dramatic reduction in ergosterol content and accumulation of farnesol and other isoprenoid intermediates

  • In serum-containing media, ERG9-depleted cells show incorporation of cholesterol in place of ergosterol

  • Overexpression of recombinant ERG9 can increase total sterol content but may also lead to accumulation of sterol intermediates if downstream enzymes become rate-limiting

Membrane Physical Properties:
These alterations in sterol composition directly affect membrane physical properties:

  • Fluidity: Changes in sterol composition alter membrane fluidity, with cholesterol-containing membranes typically displaying different fluidity characteristics than ergosterol-containing membranes

  • Thickness: The sterol composition affects membrane thickness and the ordering of phospholipid acyl chains

  • Microdomain formation: Sterols are critical for the formation of specialized membrane microdomains (lipid rafts) that serve as platforms for protein organization and signaling

Functional Consequences:
The altered membrane properties resulting from modified ERG9 expression have several functional consequences:

  • Stress tolerance: Modified sterol composition can affect tolerance to various stresses, including thermal, osmotic, and oxidative stress

  • Virulence factor expression: Membrane properties influence the expression and function of virulence factors such as secreted hydrolases and adhesins

  • Drug susceptibility: Changes in membrane composition can alter susceptibility to various antifungal agents, particularly those that target the cell membrane

Compensatory Responses:
Cells with altered ERG9 expression often display compensatory changes in:

  • Expression of other ergosterol pathway enzymes

  • Phospholipid composition to maintain appropriate membrane properties

  • Lipid transporter expression to facilitate exogenous sterol uptake, particularly in serum-containing environments

These findings highlight the central role of ERG9 in maintaining appropriate membrane composition and function, while also demonstrating the remarkable adaptability of Candida species in responding to perturbations in this essential pathway.

What are the implications of ERG9's role in sterol uptake for antifungal drug development?

The findings regarding ERG9 and sterol uptake have profound implications for antifungal drug development strategies:

Strategic Approaches to Overcome Sterol Uptake:
To develop effective ERG9-targeted therapies, several strategies could be explored:

  • Dual-targeting approaches: Combining squalene synthase inhibitors with agents that block sterol uptake from the host

  • Tissue-specific considerations: Targeting infections in tissues with limited available cholesterol, where de novo synthesis might be more critical

  • Exploiting metabolic vulnerabilities: Identifying downstream consequences of shifting from ergosterol to cholesterol in membranes that might create new therapeutic opportunities

Biomarker Development:
Understanding ERG9 regulation and sterol uptake mechanisms could lead to biomarkers that predict:

  • Which infections might respond better to particular antifungal classes

  • When combination therapies might be necessary

  • How to monitor therapeutic efficacy beyond simple growth inhibition

Table 3: Comparative Efficacy of ERG9 Targeting in Different Environments

EnvironmentERG9 EssentialityInhibitor Efficacy PredictionAlternative Sterol Source
Laboratory mediaHighHighNone available
Serum-containing mediaLowLowSerum cholesterol
In vivo (bloodstream)Very lowVery lowHost cholesterol
In vivo (tissue-specific)VariableTissue-dependentDependent on local availability

These insights suggest that rather than abandoning ERG9 as a drug target, researchers should focus on understanding the complex interplay between de novo synthesis and sterol uptake across different infection sites and physiological conditions. This nuanced approach may reveal specific clinical scenarios where targeting squalene synthase could remain a viable therapeutic strategy, particularly if combined with approaches that address the compensatory sterol uptake mechanisms.

How can recombinant C. albicans ERG9 be used in high-throughput inhibitor screening?

Recombinant C. albicans ERG9 provides an excellent platform for high-throughput screening of potential inhibitors using several methodological approaches:

Enzyme-Based Screening Assays:
Purified recombinant ERG9 can be utilized in direct enzyme inhibition assays:

  • Fluorescence-based assays: Development of non-radioactive assays using fluorescent FPP analogs allows for continuous monitoring of enzyme activity in a 96 or 384-well format

  • Coupled enzyme assays: Systems that couple squalene production to detectable secondary reactions enable real-time monitoring

  • Thermal shift assays: Measuring changes in protein thermal stability upon inhibitor binding provides a rapid screening method for compound libraries

Whole-Cell Screening Approaches:
ERG9-dependent yeast strains can be engineered for whole-cell screening:

  • Controllable expression systems: C. albicans or S. cerevisiae strains with ERG9 under a tetracycline-regulatable promoter can be maintained at minimal expression levels, making them hypersensitive to ERG9 inhibitors

  • Reporter-linked systems: Coupling ERG9 function to fluorescent or colorimetric reporters through synthetic biology approaches

Counter-Screening Strategies:
To address the challenge of sterol uptake identified in in vivo studies, effective screening campaigns should incorporate counter-screens:

  • Serum-supplemented growth assays: Testing inhibitor efficacy in the presence of serum identifies compounds that maintain activity despite available exogenous sterols

  • Sterol uptake inhibition assays: Dual screening for compounds that both inhibit ERG9 and interfere with cholesterol uptake mechanisms

Structural Guidance for Rational Design:
Beyond high-throughput screening, structural information from recombinant ERG9 can guide rational inhibitor design:

  • Homology modeling based on crystal structures of related squalene synthases

  • Molecular docking simulations to predict binding modes of potential inhibitors

  • Structure-activity relationship studies to optimize lead compounds

The screening methodology should incorporate careful consideration of physiologically relevant conditions, particularly the presence of serum components that might affect inhibitor efficacy. Additionally, compounds identified through in vitro screening should be rapidly assessed in conditions that mimic the in vivo environment where sterol uptake might circumvent ERG9 inhibition .

What techniques can be used to study ERG9 protein-protein interactions in Candida albicans?

Understanding the protein-protein interactions of ERG9 in C. albicans provides crucial insights into its regulation and integration within the sterol biosynthetic pathway. Several complementary techniques can be employed:

Affinity-Based Methods:

  • Tandem Affinity Purification (TAP-tagging):

    • Engineer C. albicans to express ERG9 with a TAP tag

    • Perform sequential purification steps to isolate intact protein complexes

    • Identify interacting partners via mass spectrometry

    • This approach preserves physiological expression levels and native interactions

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against C. albicans ERG9 or use epitope-tagged versions

    • Precipitate ERG9 along with interacting proteins

    • Verify specific interactions through immunoblotting or mass spectrometry

    • Can be performed under various physiological conditions to detect condition-specific interactions

Proximity-Based Methods:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Express ERG9 and potential partners fused to complementary fragments of a fluorescent protein

    • Interaction brings fragments together, restoring fluorescence

    • Allows visualization of interactions in living cells and their subcellular localization

  • Proximity-dependent Biotin Identification (BioID):

    • Fuse ERG9 to a promiscuous biotin ligase

    • Proteins in close proximity become biotinylated and can be purified and identified

    • Particularly useful for detecting transient or weak interactions

Genetic and Functional Methods:

  • Yeast Two-Hybrid adaptations:

    • Modified for use with C. albicans proteins

    • Screening of C. albicans genomic or cDNA libraries to identify interactors

    • Verification through reciprocal tests and secondary assays

  • Synthetic Genetic Arrays:

    • Systematic genetic interaction mapping to identify functional relationships

    • Particularly useful for identifying pathway components and regulatory factors

Structural Biology Approaches:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps protein interaction surfaces without requiring crystallization

    • Can be applied to membrane-associated forms of ERG9

    • Provides dynamic information about conformational changes upon partner binding

When studying ERG9 interactions, special consideration should be given to:

  • Its membrane association via the C-terminal domain, which may facilitate interactions with other membrane proteins

  • Potential interactions with other enzymes in the ergosterol pathway, suggesting the existence of a metabolon

  • Regulatory interactions that might mediate the observed transcriptional and post-translational control, particularly in response to serum or sterol levels

The combination of these approaches provides a comprehensive view of the ERG9 interactome and its dynamic changes under different physiological conditions relevant to pathogenesis and antifungal resistance.

How can CRISPR-Cas9 technology be applied to study ERG9 function in C. albicans?

CRISPR-Cas9 technology offers powerful approaches for investigating ERG9 function in C. albicans, enabling precise genetic manipulations that were previously challenging in this diploid organism:

Genome Editing Applications:

  • Conditional Knockout Systems:

    • Generate ERG9 conditional mutants by replacing the native promoter with regulatable promoters

    • More precise than traditional tetracycline-regulatable systems

    • Allows for temporal control of gene expression to study immediate effects of ERG9 depletion

    • Example design: Replace native ERG9 promoter with a doxycycline-repressible promoter using CRISPR-directed homologous recombination

  • Domain-Specific Mutations:

    • Introduce precise mutations to study specific functional domains:

      • Catalytic site residues to create catalytically inactive variants

      • Post-translational modification sites to study regulatory mechanisms

      • C-terminal domain modifications to alter membrane localization

    • Enables structure-function studies without completely eliminating the protein

  • Allelic Variants:

    • Generate strains expressing ERG9 variants found in clinical isolates

    • Study how specific polymorphisms affect enzyme function and antifungal susceptibility

    • Create chimeric proteins with domains from different fungal species to study species-specific functions

Transcriptional Regulation Studies:

  • CRISPRi for Targeted Repression:

    • Use catalytically inactive Cas9 (dCas9) fused to repressor domains

    • Target the ERG9 promoter for precise transcriptional repression

    • Titrate expression levels more precisely than traditional methods

    • Study dosage effects on sterol composition and membrane properties

  • CRISPRa for Activation:

    • dCas9 fused to activation domains to enhance ERG9 expression

    • Study consequences of ERG9 overexpression on sterol pathway flux and antifungal resistance

High-Throughput Functional Genomics:

  • Genetic Interaction Mapping:

    • CRISPR-based screens to identify synthetic lethal or synthetic rescue interactions with ERG9

    • Identify genes that become essential when ERG9 function is compromised

    • Discover potential combination therapy targets that could prevent sterol uptake compensation

  • Pooled CRISPR Screens:

    • Generate libraries targeting ERG9 regulatory elements

    • Screen for variants that alter antifungal susceptibility or virulence

    • Identify critical regulatory regions that respond to environmental conditions

Implementation Considerations:

When applying CRISPR technologies to study ERG9 in C. albicans, researchers should consider:

  • The diploid nature of C. albicans, requiring modification of both alleles

  • Optimization of CRISPR components for efficient function in this organism

  • Careful phenotypic characterization under both laboratory and serum-containing conditions

  • Validation of findings in animal models, given the demonstrated differences between in vitro and in vivo essentiality

CRISPR-based approaches provide unprecedented precision for studying ERG9 function and regulation, potentially revealing new insights into its role in pathogenesis and identifying more effective strategies for therapeutic targeting that account for the compensatory mechanisms observed in vivo.

How does C. albicans ERG9 differ structurally and functionally from homologs in other fungi and humans?

C. albicans ERG9 exhibits important structural and functional differences from its homologs in other organisms, with significant implications for selective targeting:

  • The substrate binding pocket architecture

  • The C-terminal membrane association domain

  • Regulatory regions that control post-translational modifications

  • Substrate affinity: C. albicans ERG9 exhibits different kinetic parameters compared to the human enzyme

  • Cofactor requirements: While both require Mg²⁺ and NADPH, the optimal concentrations and binding affinities differ

  • Response to inhibitors: Species-specific differences in inhibitor sensitivity provide opportunities for selective targeting

Regulatory Mechanisms:
A significant functional difference lies in the regulatory mechanisms:

  • C. albicans ERG9 is regulated by fungal-specific transcription factors not present in humans

  • Post-translational modifications differ between fungal and human enzymes

  • The response to sterols shows species-specific patterns, with fungal enzymes more tightly regulated by ergosterol levels than human enzymes are by cholesterol levels

Membrane Association:
The C-terminal hydrophobic domain that mediates membrane association differs significantly between fungal and human enzymes:

  • Fungal ERG9 enzymes can be made soluble by truncating this domain while retaining activity

  • The precise membrane localization and interaction with other ergosterol pathway enzymes may differ between species

  • These differences affect the accessibility of the enzyme to water-soluble inhibitors

Table 4: Comparison of Squalene Synthase Across Species

FeatureC. albicansS. cerevisiaeHumanSignificance
Protein length~443 aa~444 aa417 aaStructural differences
C-terminal domainPresent, removablePresent, removablePresent, differentTarget for solubilization
Optimal pH7.2-7.47.2-7.47.4-7.6Similar catalytic conditions
Sterol uptake compensationEfficientEfficientNot applicableChallenge for drug targeting
Essential in vivoNo (with serum)No (with serum)YesDifferences in drug target potential

These structural and functional differences provide the foundation for developing selective inhibitors that target fungal squalene synthases while sparing the human enzyme, though the ability of fungi to compensate through sterol uptake remains a significant challenge for therapeutic applications .

What evolutionary insights can be gained from comparing ERG9 sequences across Candida species?

Comparative analysis of ERG9 sequences across Candida species provides valuable evolutionary insights into sterol metabolism adaptation and pathogenicity:

Phylogenetic Relationships:
ERG9 sequences can be used to construct phylogenetic trees that reflect the evolutionary relationships among Candida species. These analyses typically reveal:

  • Clustering that generally aligns with established taxonomic relationships

  • Evidence of selective pressure on specific domains, particularly those involved in catalysis and regulation

  • Conservation patterns that highlight functionally critical residues across diverse species

Selective Pressure Analysis:
Calculating the ratio of nonsynonymous to synonymous substitutions (dN/dS) across different regions of the ERG9 gene reveals:

  • Strong purifying selection on catalytic domains, indicating functional constraints

  • Variable selection pressure on regulatory regions, suggesting adaptation to different niches

  • Potential episodes of positive selection associated with host adaptation or antifungal exposure

Functional Domain Evolution:
Different functional domains of ERG9 show distinct evolutionary patterns:

  • The catalytic core shows the highest conservation across species

  • The C-terminal membrane-association domain displays greater variability

  • Regulatory regions and potential post-translational modification sites show species-specific patterns, reflecting adaptation to different environmental conditions

Host Adaptation Signatures:
Comparing ERG9 sequences from different Candida species reveals potential adaptations to different host environments:

  • Species that frequently encounter serum environments show adaptations in sterol regulatory regions

  • Variations in domains related to sterol uptake efficiency correlate with pathogenicity patterns

  • Species-specific adaptations may reflect different strategies for balancing de novo synthesis versus host sterol uptake

Implications for Antifungal Resistance:
Evolutionary analyses can identify:

  • Naturally occurring variants that might confer different levels of susceptibility to ERG9 inhibitors

  • Regions with higher mutation rates that might facilitate rapid adaptation under drug pressure

  • Co-evolutionary patterns with other ergosterol pathway enzymes that might influence resistance mechanisms

These evolutionary insights not only enhance our understanding of ERG9's role in Candida biology but also inform strategies for developing broad-spectrum antifungal agents that remain effective against diverse Candida species. The identification of universally conserved regions critical for function across species provides valuable targets for drug development, while understanding species-specific adaptations helps predict potential resistance mechanisms and compensatory pathways.

How can structural models of C. albicans ERG9 be developed and utilized for inhibitor design?

Developing and utilizing structural models of C. albicans ERG9 for inhibitor design involves a multifaceted approach combining computational methods with experimental validation:

Homology Modeling Approaches:
Since a crystal structure for C. albicans ERG9 is not currently available, homology modeling provides the primary approach for structural prediction:

  • Template Selection:

    • Human squalene synthase crystal structures (e.g., PDB: 1EZF, 3VJ8) serve as primary templates

    • Structures of other fungal homologs, when available, provide additional templates

    • Multiple templates can be combined to improve model accuracy, particularly for regions with varying conservation

  • Model Refinement:

    • Energy minimization to resolve steric clashes

    • Molecular dynamics simulations to sample conformational space

    • Loop refinement for regions with low template similarity

    • Incorporation of experimental data from mutagenesis studies to validate and improve the model

Model Validation and Improvement:
Several approaches can validate and improve initial homology models:

Structure-Based Inhibitor Design:
Validated structural models enable several approaches to inhibitor design:

  • Virtual Screening:

    • Docking of compound libraries against the active site

    • Pharmacophore-based screening using the spatial arrangement of key binding site features

    • Fragment-based approaches to identify building blocks for novel inhibitors

  • Rational Design Strategies:

    • Focus on fungal-specific features that differ from the human enzyme

    • Target allosteric sites identified through molecular dynamics simulations

    • Design of compounds that exploit the unique C-terminal domain interface with the membrane

  • Optimizing Selectivity:

    • Identify binding pocket differences between fungal and human enzymes

    • Design inhibitors that exploit these differences to achieve selectivity

    • Incorporate features that reduce binding to human squalene synthase

Table 5: Key Structural Features for Inhibitor Design

Structural RegionSignificance for Inhibitor DesignDesign Strategy
Catalytic siteEssential for enzyme functionCompetitive inhibitors mimicking FPP or reaction intermediates
NADPH binding pocketRequired for reductive stepCompounds that interfere with cofactor binding
Species-specific pocket extensionsDiffer between human and fungal enzymesExploit for selectivity
Allosteric sitesModulate enzyme activityNon-competitive inhibitors
Membrane interfaceCritical for proper positioningCompounds that disrupt membrane association

Special considerations for ERG9 inhibitor design include:

  • The demonstrated ability of Candida species to utilize host sterols when ERG9 is inhibited

  • The need for inhibitors that maintain activity in serum-containing environments

  • Potential for combination approaches targeting both ERG9 and sterol uptake mechanisms

By iteratively refining structural models with experimental data and focusing on fungal-specific features, researchers can develop increasingly selective and effective inhibitors of C. albicans ERG9, while accounting for the compensatory mechanisms that have been identified in in vivo studies.

What are common challenges in expressing and purifying active recombinant C. albicans ERG9?

Researchers working with recombinant C. albicans ERG9 face several technical challenges that require specific troubleshooting strategies:

Expression Challenges:

  • Membrane Association Issues:

    • Challenge: The C-terminal hydrophobic domain causes protein aggregation and inclusion body formation in E. coli

    • Solution: Generate truncated constructs removing approximately 24 amino acids from the C-terminus, as successfully implemented with S. cerevisiae ERG9

    • Alternative: Use specialized E. coli strains designed for membrane protein expression (C41, C43) with lower induction temperatures (16-20°C)

  • Codon Bias:

    • Challenge: C. albicans uses a non-canonical genetic code where CTG encodes serine instead of leucine

    • Solution: Optimize codons for E. coli expression or use CTG-adjusted E. coli strains

    • Alternative: Express in Pichia pastoris or S. cerevisiae to maintain proper translation

  • Protein Toxicity:

    • Challenge: Overexpression disrupts E. coli membrane integrity

    • Solution: Use tightly controlled inducible promoters (T7lac) with reduced inducer concentrations

    • Alternative: Use autoinduction media for gradual protein expression

Purification Challenges:

  • Limited Solubility:

    • Challenge: Even truncated variants show limited solubility

    • Solution: Include detergents (1% Tween 80) in lysis and purification buffers

    • Alternative: Use fusion tags (MBP, SUMO) to enhance solubility

  • Stability Issues:

    • Challenge: Enzyme loses activity rapidly during purification

    • Solution: Include protease inhibitors, reducing agents (5 mM DTT), and glycerol (10%)

    • Alternative: Perform purification at 4°C with minimal exposure to air

  • Co-purifying Contaminants:

    • Challenge: Bacterial proteins with similar properties co-purify

    • Solution: Implement a two-step chromatography approach (hydroxyapatite followed by phenyl-Superose)

    • Alternative: Use affinity tags with specific elution conditions

Activity Measurement Challenges:

  • Assay Sensitivity:

    • Challenge: Traditional radioactive assays require specialized facilities

    • Solution: Develop LC-MS or fluorescence-based alternative assays

    • Alternative: Use coupled enzyme assays that produce measurable products

  • Substrate Availability:

    • Challenge: FPP is expensive and unstable

    • Solution: Prepare fresh FPP solutions and store small aliquots at -80°C

    • Alternative: Establish in-house FPP synthesis from less expensive precursors

Table 6: Troubleshooting Strategies for Common ERG9 Expression Issues

IssueSymptomsPotential Solutions
Inclusion body formationLow soluble yield, protein in pelletTruncate C-terminus, lower induction temperature, add solubilizing agents
Low enzymatic activityPurified protein shows minimal catalysisAdd detergents (1% Tween 80), ensure NADPH freshness, include Mg²⁺
Protein instabilityActivity loss during storageAdd 10% glycerol, 1 mM DTT, store at -80°C in single-use aliquots
Poor yieldLow total protein recoveryOptimize induction conditions, use richer media, extend expression time at lower temperatures
Aggregation during concentrationPrecipitation during final preparationAdd detergents or mild solubilizing agents, use gradual concentration methods

By implementing these targeted troubleshooting strategies, researchers can overcome the technical challenges associated with recombinant C. albicans ERG9, achieving sufficient quantities of active enzyme for structural, functional, and inhibitor development studies.

How can inconsistencies between in vitro and in vivo ERG9 inhibitor efficacy be addressed?

The striking discrepancy between in vitro and in vivo efficacy of ERG9 inhibitors poses a significant challenge for antifungal drug development. Several strategies can address these inconsistencies:

Understanding the Mechanistic Basis:

  • Characterize Sterol Uptake Mechanisms:

    • Identify and characterize the specific transporters involved in cholesterol uptake

    • Determine if these mechanisms vary between Candida species

    • Map the regulatory pathways that control transporter expression in response to ERG9 inhibition

  • Develop More Predictive Models:

    • Create laboratory media formulations that better mimic in vivo conditions

    • Establish cell culture systems that incorporate serum or specific host factors

    • Develop ex vivo infection models that maintain relevant host-pathogen interactions

Experimental Design Improvements:

  • Staged Screening Approach:

    • Initial screens in standard media to identify ERG9 inhibitors

    • Secondary screens in serum-containing media to identify compounds that maintain efficacy

    • Tertiary screens in animal models or ex vivo systems for final validation

  • Biomarker Development:

    • Identify cellular markers that predict in vivo efficacy more accurately than growth inhibition

    • Develop assays for specific sterol species that indicate ERG9 inhibition in vivo

    • Monitor both fungal and host responses to capture the full complexity of drug effects

Novel Therapeutic Strategies:

  • Dual-Target Inhibitors:

    • Design compounds that simultaneously inhibit ERG9 and block sterol uptake

    • Create inhibitors that target multiple enzymes in the ergosterol pathway

    • Develop agents that inhibit ERG9 and disrupt membrane function through complementary mechanisms

  • Combination Therapy Approaches:

    • Pair ERG9 inhibitors with agents that block sterol uptake

    • Combine with drugs that target other aspects of membrane function

    • Use with agents that compromise the adaptive responses to ERG9 inhibition

  • Exploiting Niche-Specific Requirements:

    • Target infections in anatomical sites with limited cholesterol availability

    • Develop delivery systems that maintain high local drug concentrations

    • Identify physiological states where de novo synthesis becomes more critical

Table 7: Strategies to Address In Vitro vs. In Vivo Discrepancies

StrategyImplementation ApproachExpected Outcome
Predictive screening modelsIncorporate serum components in early screeningBetter translation to in vivo efficacy
Sterol uptake inhibitorsHigh-throughput screening for uptake blockersCompounds that enhance ERG9 inhibitor efficacy
Membrane localizationTarget ERG9 in its native membrane environmentInhibitors less affected by compensatory mechanisms
Stress-inducing combinationsPair with oxidative stress inducersOverwhelm compensatory responses
Site-specific deliveryDevelop targeted drug delivery systemsAchieve inhibitory concentrations despite uptake

The significant disparity between in vitro potency and in vivo efficacy of ERG9 inhibitors seen in C. glabrata studies should not completely discourage research in this area, but rather guide more sophisticated approaches that account for the adaptive capabilities of pathogenic fungi. By understanding and targeting both ERG9 and the compensatory mechanisms that are activated in vivo, researchers may still develop effective therapeutic strategies based on this important biosynthetic enzyme.

What experimental controls are essential when studying ERG9 regulation and function?

Robust experimental design for studying ERG9 regulation and function requires thoughtful implementation of several essential controls:

Genetic Manipulation Controls:

  • Complementation Controls:

    • When creating ERG9 deletions or mutations, include strains complemented with wild-type ERG9 to confirm phenotype specificity

    • Express the wild-type gene from both native and ectopic loci to control for positional effects

    • Include heterologous complementation with orthologous genes to assess functional conservation

  • Promoter Replacement Controls:

    • When using regulatable promoter systems (like tetracycline-responsive promoters):

      • Include strains where non-essential genes are under the same promoter control

      • Monitor expression levels directly (via RT-qPCR or Western blotting)

      • Test multiple independent transformants to control for integration site effects

Expression and Purification Controls:

  • Enzymatic Activity Controls:

    • Include known inhibitors at defined concentrations to validate assay functionality

    • Test enzymatic parameters (pH optimum, cofactor requirements) to confirm proper folding

    • Compare truncated and full-length versions where feasible to evaluate functional impacts

  • Protein Quality Controls:

    • Assess protein homogeneity through multiple methods (SDS-PAGE, size exclusion chromatography)

    • Verify identity through mass spectrometry or N-terminal sequencing

    • Use thermostability assays to confirm proper folding

Growth and Phenotypic Analysis Controls:

  • Media and Environmental Controls:

    • Test phenotypes in multiple media formulations (defined media, rich media)

    • Include serum-containing and serum-free conditions when evaluating growth

    • Assess growth across a range of temperatures and pH conditions

  • Sterol Supplementation Controls:

    • Include conditions with exogenous ergosterol or cholesterol

    • Use sterol biosynthesis inhibitors with known mechanisms as positive controls

    • Test related lipid supplements to confirm specificity of sterol effects

In Vivo Experiment Controls:

  • Drug Administration Controls:

    • For regulatable promoter systems, monitor inducer/repressor levels in tissues

    • Include mock-treated controls matched for vehicle and administration schedule

    • Verify gene expression/repression directly in recovered fungal cells

  • Host Factor Controls:

    • Use immunocompromised and immunocompetent animal models to assess host contributions

    • Consider testing in animals with altered cholesterol metabolism

    • Include tissue-specific analyses to account for varying microenvironments

Table 8: Essential Controls for Common ERG9 Experimental Approaches

Experimental ApproachEssential ControlsRationale
Promoter replacementWild-type strain, strain with control gene under same promoterDistinguish specific from non-specific effects of the regulatory system
Enzyme activity assaysKnown inhibitors, heat-inactivated enzyme, no-substrate controlValidate assay functionality and specificity
Growth phenotypingMultiple media types, serum supplementation, sterol additionAccount for environmental effects on sterol requirements
In vivo studiesVerify drug penetration, monitor gene expression in recovered cellsEnsure the expected molecular effect is achieved in vivo
Inhibitor testingInclude serum-containing conditions, test multiple Candida speciesPredict potential compensatory mechanisms

Implementing these controls ensures that experimental observations can be confidently attributed to specific effects on ERG9 function rather than technical artifacts or secondary effects of the experimental manipulations. This is particularly important given the complex regulation of sterol metabolism and the significant differences observed between in vitro and in vivo conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.