Recombinant Candida apicola Cytochrome P450 52E2 (CYP52E2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP52E2; Cytochrome P450 52E2; CYPLIIE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-519
Protein Length
full length protein
Species
Candida apicola (Yeast)
Target Names
CYP52E2
Target Protein Sequence
MNINFSDALMLGGISLSFLLASQAIYFYFIYSPRAKKLGCAPPPIFFSFPLGIPDLIRLV NAWFHDDLLEWFTHRFEEFGRRTAFQSVAGQLWIGTIEPENIKTMLATSFKDYSLGFRYN AMYGLLGNGIFTLSGDGWKNSRALLRPQFSREQVSHLESMRTHINMMINNHFKGGQVVDA QVLYHNLTIDTATEFLFGESTNTLDPALAQQGLPGPKGLVTGEQFAEAFTSALELLSVRV MAGAAWFLVWTPKFWRSCKVCHNFIDYFVYKALATPMEKGQDADRYVFIRELTKETSDPR VIRDQALNILLAGRDTTAALLSFTTYYLGAYPEVYDELREAVIADFGSADAEPPTFEQLK QCKVLQNVIREVLRLHPNVPLNFREAIADTTFPTGGGPNGDQPIFVPKGQKVFYATYVMQ RNAGIWGPDSTSFRPDRWNEPREALASGWDYIPFNGGPRICLGQQFALTEASYTLVRICQ EFSRIEVLHPDVITARNVMKQRMRLPNSSSGGVITRFIR
Uniprot No.

Target Background

Function

In conjunction with an NADPH cytochrome P450 enzyme system, this enzyme catalyzes the terminal hydroxylation, initiating the assimilation of alkanes and fatty acids.

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane. Membrane; Multi-pass membrane protein.

Q&A

What is Candida apicola CYP52E2 and what is its biological role?

CYP52E2 is one of multiple cytochrome P450 enzymes identified in Candida apicola, a highly osmotolerant ascomycetes yeast known for producing surface-active extracellular glycolipids (sophorolipids). These glycolipids consist of sophorose linked to long-chain-omega and (omega-1)-hydroxy fatty acids. CYP52E2 plays a crucial role in the biosynthesis of these sophorolipids by catalyzing the terminal (ω) or subterminal (ω-1) hydroxylation of long-chain fatty acids, which is a key step in sophorolipid production. The involvement of cytochrome P450 enzymes in this process was initially suggested when researchers observed simultaneous increases in cellular P450 content during sophorolipid synthesis . Beyond fatty acid hydroxylation, studies have indicated that C. apicola P450 enzymes, including CYP52E2, can also hydroxylate n-alkanes, suggesting versatility in substrate recognition .

How was CYP52E2 originally identified and characterized?

CYP52E2 was originally identified through a molecular biology approach using polymerase chain reaction (PCR) with heterologous primers designed based on conserved regions of P450 enzymes. Researchers amplified P450 DNA fragments from chromosomal DNA of Candida apicola, which were then used as homologous probes to isolate full-length clones from a genomic library. Sequence analysis revealed two distinct but closely related P450 genes, which were designated as CYP52E1 and CYP52E2 according to the P450 nomenclature system, establishing a new subfamily within the yeast CYP52 family .

The open reading frame of CYP52E2 encodes a protein of 519 amino acids with a calculated molecular weight of 58,631 Da. The protein contains characteristic features of eukaryotic P450s, including an N-terminal membrane anchor sequence and conserved hallmark residues essential for P450 function . Southern hybridization experiments further suggested the existence of additional P450-related genes in C. apicola, indicating a complex P450 enzyme system in this organism .

What genomic resources are available for studying CYP52E2?

A high-quality draft genome sequence of Candida apicola NRRL Y-50540 has been published, providing a valuable reference for molecular studies of this organism. The genome assembly consists of 9,769,876 bp distributed across 40 contigs with an average G+C content of 41.6%, similar to other Candida species . Gene prediction analysis identified 3,818 protein-coding genes, with genome completeness estimated at 92% using CEGMA v2.5 .

This genomic resource enables various advanced research approaches, including:

  • Identification and analysis of all potential P450 genes in C. apicola

  • Comparative genomic studies with other yeasts

  • Differential gene expression analysis under various conditions

  • Targeted genetic modifications to study gene function

  • Identification of regulatory elements controlling CYP52E2 expression

The availability of this genome sequence represents a significant advancement for researchers studying C. apicola enzymes of biotechnological interest, including CYP52E2 .

What are the key structural features of CYP52E2?

CYP52E2 exhibits several structural features typical of eukaryotic cytochrome P450 enzymes:

  • Protein size and composition: The enzyme consists of 519 amino acids with a calculated molecular weight of 58,631 Da .

  • Membrane anchoring domain: CYP52E2 contains an N-terminal membrane anchor sequence, which is characteristic of eukaryotic P450s and facilitates association with the endoplasmic reticulum membrane .

  • Conserved structural elements: The protein contains hallmark residues common to other eukaryotic P450s, including the highly conserved heme-binding region typically containing a cysteine residue that serves as the fifth ligand to the heme iron .

  • Sequence homology: The deduced amino acid sequence of CYP52E2 shares 84.4% identity with CYP52E1 from the same organism, indicating they likely arose from gene duplication. It also shares 34.5-44.1% identity with other proteins of the yeast CYP52 family and approximately 25% identity with fatty acid hydroxylases from higher eukaryotes (CYP4A family) and Bacillus megaterium (CYP102) .

These structural features are consistent with the enzyme's function in hydroxylating long-chain fatty acids and n-alkanes, activities that are important for sophorolipid biosynthesis in C. apicola.

How does CYP52E2 compare to related P450 enzymes?

A comparative analysis of CYP52E2 with related P450 enzymes reveals several important relationships:

P450 EnzymeRelationship to CYP52E2Sequence IdentityFunctional Similarity
CYP52E1 (C. apicola)Paralog84.4%Hydroxylation of fatty acids and n-alkanes
CYP52 family (other yeasts)Orthologs34.5-44.1%Alkane and fatty acid hydroxylation
CYP4A family (higher eukaryotes)Distant homologs~25%Fatty acid hydroxylation
CYP102 (Bacillus megaterium)Distant homolog~25%Fatty acid hydroxylation

This pattern of sequence conservation suggests that while the catalytic function (hydroxylation of long-chain hydrocarbons) is preserved across diverse P450 families, there are likely significant differences in substrate specificity, regulation, and possibly reaction efficiency. The higher degree of conservation within the CYP52 family suggests a common evolutionary origin and similar physiological roles among these enzymes in different yeast species .

What expression systems are most effective for producing recombinant CYP52E2?

Based on successful approaches with related P450 enzymes, several expression systems can be considered for recombinant CYP52E2 production:

  • Escherichia coli: This system has been successfully used for the expression of the related cytochrome P450 reductase (CPR) from C. apicola. The CPR gene was cloned into E. coli and expressed in functional form after truncation of its N-terminal membrane anchor . A similar approach could be applied to CYP52E2, potentially using specialized E. coli strains optimized for membrane protein expression.

  • Yeast expression systems: Given that CYP52E2 is natively expressed in yeast, heterologous expression in Saccharomyces cerevisiae or Pichia pastoris may provide appropriate post-translational modifications and membrane environment. These systems often yield properly folded and functional P450 enzymes.

  • Baculovirus-insect cell system: This eukaryotic expression system is frequently used for recombinant P450 production due to its capacity for high-level expression and appropriate post-translational modifications.

Each expression system has specific advantages and challenges:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliHigh yield, ease of genetic manipulation, cost-effectivePotential for improper folding, lack of post-translational modificationsN-terminal modification, co-expression with chaperones
Yeast systemsNative-like environment, appropriate post-translational modificationsLower yield than E. coliCodon optimization, selection of strong promoters
Baculovirus-insect cellsHigh expression levels, proper foldingTime-consuming, expensiveOptimize MOI, harvest time

What are the critical considerations for maintaining CYP52E2 activity during purification?

Purification of functional CYP52E2 requires careful attention to several factors:

  • Membrane solubilization: As a membrane-bound enzyme, CYP52E2 requires appropriate detergents for solubilization. The choice of detergent is critical for maintaining proper folding and activity.

  • Heme retention: P450 enzymes contain a heme prosthetic group essential for catalytic activity. Purification conditions should minimize heme loss.

  • Oxidation prevention: The cysteine residue that coordinates with the heme iron is susceptible to oxidation, which can inactivate the enzyme. The inclusion of reducing agents and performing purification steps under anaerobic conditions may help preserve activity.

  • Protein stability: CYP52E2 stability can be enhanced by including glycerol (typically 10-20%) in buffers and maintaining appropriate pH and ionic strength.

  • Redox partner requirements: For functional assays, CYP52E2 requires a suitable redox partner. The cytochrome P450 reductase from C. apicola has been characterized and could be co-expressed or added during activity assays .

How can the catalytic activity of CYP52E2 be measured in vitro?

Several methodological approaches can be employed to assess CYP52E2 activity:

  • Substrate hydroxylation assays: Direct measurement of fatty acid or n-alkane hydroxylation using chromatographic methods (GC-MS or LC-MS) to detect and quantify hydroxylated products.

  • NADPH consumption assays: Monitoring the oxidation of NADPH (decrease in absorbance at 340 nm) in the presence of CYP52E2, its redox partner, and substrate.

  • Oxygen consumption assays: Using an oxygen electrode to measure the rate of oxygen consumption during the catalytic cycle.

  • Spectroscopic assays: Observing substrate-induced spectral changes in the heme absorption spectrum, which can provide information about substrate binding.

A typical reaction setup would include:

  • Purified recombinant CYP52E2

  • Cytochrome P450 reductase (preferably from C. apicola)

  • NADPH or an NADPH-regenerating system

  • Appropriate substrate (long-chain fatty acid or n-alkane)

  • Suitable buffer system (typically phosphate buffer pH 7.4)

  • Detergent or lipid vesicles to maintain enzyme solubility

What is known about the electron transfer system for CYP52E2?

While specific information about the electron transfer system for CYP52E2 is limited in the provided search results, insights can be drawn from studies on C. apicola cytochrome P450 reductase (CPR):

The CPR from C. apicola has been cloned and characterized. It is a diflavin reductase encoded by a gene that translates to a protein of 687 amino acids. The enzyme contains an N-terminal membrane anchor, which was removed for functional expression in E. coli. The truncated recombinant protein demonstrated cytochrome c reducing activity with a Km of 13.8 μM and a kcat of 1,915 per minute .

This CPR can transfer electrons to bacterial P450s (CYP109B1 and CYP154E1), suggesting it may have broad compatibility with various P450 enzymes . This versatility makes it a promising electron transfer partner for functional studies of CYP52E2.

The electron transfer typically follows this pathway:

  • NADPH binds to CPR

  • Electrons are transferred from NADPH to FAD

  • Electrons move from FAD to FMN within the CPR

  • FMN transfers electrons to the heme iron of the P450 enzyme

  • The P450 uses these electrons to activate molecular oxygen for substrate hydroxylation

For reconstituting CYP52E2 activity in vitro, the native C. apicola CPR would be the preferred redox partner.

How can CYP52E2 be utilized for the production of sophorolipids?

CYP52E2 plays a crucial role in sophorolipid biosynthesis by catalyzing the hydroxylation of long-chain fatty acids, a key step in the pathway. Potential applications of recombinant CYP52E2 in sophorolipid production research include:

  • Pathway engineering: Overexpression of CYP52E2 in C. apicola or other yeast hosts could potentially increase the rate of fatty acid hydroxylation, potentially enhancing sophorolipid yields.

  • Substrate specificity studies: Investigating the range of fatty acid substrates accepted by CYP52E2 could inform the production of novel sophorolipids with modified fatty acid components.

  • Process optimization: Understanding the catalytic parameters of CYP52E2 (optimal temperature, pH, cofactor requirements) could guide bioprocess development for sophorolipid production.

  • Whole-cell biocatalysis: Recombinant microorganisms expressing CYP52E2 could be developed as biocatalysts for the specific hydroxylation of fatty acids, providing precursors for sophorolipid synthesis.

Sophorolipids have applications as biodegradable surfactants and antimicrobial agents, making this research area particularly relevant to sustainable chemistry and green technology .

What are the potential advantages of using CYP52E2 for biocatalytic applications?

CYP52E2 offers several advantages as a biocatalytic tool:

  • Regioselectivity: P450 enzymes often exhibit high regioselectivity in hydroxylation reactions, which can be difficult to achieve through chemical synthesis. CYP52E2 appears to specifically hydroxylate the terminal (ω) or subterminal (ω-1) positions of fatty acids .

  • Mild reaction conditions: As an enzyme, CYP52E2 functions under physiological conditions (aqueous environment, ambient temperature, neutral pH), aligning with green chemistry principles.

  • Substrate versatility: CYP52E2 can hydroxylate both fatty acids and n-alkanes, making it potentially applicable to multiple biocatalytic processes .

  • Compatibility with bacterial P450 systems: The related C. apicola CPR has demonstrated the ability to transfer electrons to bacterial P450s, suggesting potential compatibility with various P450 systems . This could enable the development of hybrid enzyme systems combining the advantages of different P450 enzymes.

  • Evolutionary adaptation to osmotic stress: As C. apicola is highly osmotolerant, its enzymes, including CYP52E2, may exhibit stability under conditions that would denature proteins from other organisms, potentially allowing for unique reaction environments .

What protein engineering approaches might enhance CYP52E2 activity or stability?

Several protein engineering strategies could be employed to optimize CYP52E2 for research or biotechnological applications:

  • Rational design: Based on structural analysis and comparison with related P450 enzymes, targeted mutations could be introduced to:

    • Enhance substrate binding

    • Improve electron transfer efficiency

    • Increase protein stability

    • Modify regioselectivity of hydroxylation

  • Directed evolution: Iterative rounds of random mutagenesis and screening could identify variants with improved properties such as:

    • Higher catalytic efficiency

    • Broadened substrate scope

    • Enhanced thermostability

    • Increased tolerance to organic solvents

  • Domain swapping: Exchanging domains between CYP52E2 and other P450 enzymes might create chimeric proteins with novel properties.

  • N-terminal modifications: As demonstrated with the C. apicola CPR, truncation or modification of the N-terminal membrane anchor might improve expression in heterologous systems while maintaining activity .

  • Cofactor engineering: Designing self-sufficient systems by creating fusion proteins between CYP52E2 and its redox partner could improve electron transfer efficiency and simplify biocatalytic applications.

How might systems biology approaches enhance our understanding of CYP52E2 function?

Systems biology approaches offer powerful tools for investigating CYP52E2 in its biological context:

  • Transcriptomics: RNA-Seq analysis under various conditions (different carbon sources, osmotic stress, etc.) could reveal how CYP52E2 expression is regulated in C. apicola. The available genome sequence provides a reference for such studies .

  • Proteomics: Mass spectrometry-based proteomics could identify post-translational modifications of CYP52E2 and detect protein-protein interactions with redox partners or other cellular components.

  • Metabolomics: Profiling the sophorolipids and other metabolites produced by wild-type C. apicola versus CYP52E2 mutants could provide insights into the enzyme's role in cellular metabolism.

  • Flux analysis: Tracking the flow of carbon through fatty acid metabolism and sophorolipid biosynthesis could reveal bottlenecks and regulatory points in the pathway.

  • Comparative genomics: The high-quality draft genome of C. apicola enables comparative analyses with other yeasts to understand the evolution and specialization of the CYP52 family .

  • Synthetic biology: Reconstituting the sophorolipid biosynthetic pathway in heterologous hosts could provide a clean background for studying CYP52E2 function without interference from other C. apicola enzymes.

What are common challenges when working with recombinant CYP52E2?

Researchers may encounter several technical challenges when working with recombinant CYP52E2:

  • Expression yield: As a membrane protein, CYP52E2 may express at lower levels than soluble proteins. This might be addressed by optimizing codon usage, culture conditions, and selecting appropriate host strains.

  • Protein misfolding: P450 enzymes require proper incorporation of the heme cofactor and correct folding. Supplementation with δ-aminolevulinic acid (a heme precursor) and expression at lower temperatures may improve folding.

  • Maintaining activity during purification: The activity of CYP52E2 may decrease during purification due to detergent effects, heme loss, or oxidative damage. Screening different detergents and including stabilizing agents in purification buffers can help preserve activity.

  • Assay interference: Components of the reaction mixture (detergents, lipids, redox partners) may interfere with activity assays. Careful optimization of assay conditions and appropriate controls are essential.

  • Redox partner compatibility: Efficient electron transfer requires compatibility between CYP52E2 and its redox partner. While the native C. apicola CPR would be ideal, it may not always be available, necessitating screening of alternative redox systems .

How can researchers distinguish between CYP52E2 and CYP52E1 in experimental systems?

Given the high sequence identity (84.4%) between CYP52E1 and CYP52E2 , distinguishing between these paralogs can be challenging but essential for accurate research. Several approaches can help:

  • Gene-specific PCR: Design primers targeting unique regions of each gene for specific amplification.

  • Selective antibodies: Develop antibodies against peptide regions that differ between the two proteins for immunological detection.

  • Mass spectrometry: Identify unique peptide fragments that can discriminate between the two proteins in proteomic analyses.

  • Heterologous expression: Express each gene individually in a heterologous host to study their properties in isolation.

  • CRISPR-Cas9 gene editing: Create specific gene knockouts in C. apicola to study the function of each gene independently.

  • Enzyme kinetics: Determine if the two enzymes have different substrate preferences or kinetic parameters that can serve as distinguishing characteristics.

  • Recombinant protein tagging: Add different epitope tags to each protein when expressing them recombinantly to facilitate their identification and purification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.