Recombinant Candida boidinii Peroxisomal membrane protein PMP47A (PMP47A)

Shipped with Ice Packs
In Stock

Description

Genetic Characteristics and Expression

The PMP47A gene is one of two closely related genes (or alleles) identified in Candida boidinii, with the other being PMP47B . These two genes share remarkable similarity, with approximately 95% sequence identity at the amino acid level . In the polyploidal strain ATCC32195 of C. boidinii, both PMP47A and PMP47B are present, while the haploid strain S2 contains a single PMP47 gene that closely resembles both PMP47A and PMP47B .

The gene encoding PMP47A contains an open reading frame of 1269 base pairs . Expression studies have demonstrated that the RNA corresponding to PMP47A is strongly induced by various substrates including methanol, oleic acid, and D-alanine, all of which trigger peroxisomal proliferation in Candida boidinii . This pattern of induction corroborates the protein's significance in peroxisomal metabolism across different metabolic pathways.

Recombinant Expression Systems

For research and commercial purposes, recombinant PMP47A is typically expressed in Escherichia coli expression systems with an N-terminal His tag to facilitate purification . This approach yields protein with greater than 90% purity as determined by SDS-PAGE analysis . The recombinant protein is generally supplied as a lyophilized powder and requires proper reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50% final concentration) recommended for long-term storage .

Interestingly, PMP47A has also been successfully expressed in Saccharomyces cerevisiae for research purposes . When expressed in S. cerevisiae cells grown on oleic acid to induce peroxisomes, the protein was observed exclusively in peroxisomal membranes, demonstrating that the protein contains all necessary information for proper sorting and assembly into peroxisomal membranes even in a heterologous host .

Functional Significance

PMP47A belongs to a family of mitochondrial solute transporters, exemplified by the ATP/ADP exchanger, and represents the only known peroxisomal member of this transporter family . This distinctive classification suggests a specialized role in transporting specific substrates across the peroxisomal membrane, thereby facilitating peroxisomal metabolism.

Gene disruption studies have provided crucial insights into PMP47A's functional importance. Deletion of the PMP47 gene in the S2 strain of Candida boidinii resulted in significant phenotypic changes, including retarded growth on oleate and complete growth inhibition on methanol . Both of these substrates require peroxisomal metabolism for their utilization, highlighting PMP47A's essential role in these metabolic pathways.

Role in Protein Folding and Import

One of the most significant findings regarding PMP47A's function comes from detailed analyses of the PMP47-disrupted strain (pmp47delta). In methanol-induced cells lacking PMP47, researchers observed that dihydroxyacetone synthase (DHAS), a key peroxisomal matrix enzyme, was enzymatically inactive and aggregated in the cytoplasm as an inclusion body . Remarkably, two other peroxisomal matrix enzymes, alcohol oxidase and catalase, remained active and properly localized to peroxisomes in the same cells.

Further investigations involving peroxisome-deficient mutant strains (M6 and M13) revealed that when PMP47 was disrupted in these backgrounds, DHAS remained enzymatically active despite its mislocalization to the cytoplasm and nucleus . These observations led researchers to propose that PMP47A transports an unknown small molecule necessary for the folding or translocation machinery of DHAS within peroxisomes . The protein does not directly catalyze protein folding, as evidenced by the preservation of DHAS activity in the M6-pmp47delta and M13-pmp47delta strains.

This specific impact on DHAS, but not on other PTS1-containing proteins like alcohol oxidase, suggests that PMP47A can dissect the peroxisomal import pathway of these proteins, despite their shared targeting signal . This finding has significant implications for understanding the complexities of peroxisomal protein import mechanisms.

Morphological Impact on Peroxisomes

Electron microscopy observations of the pmp47delta strain revealed that peroxisomes were still present in methanol- and oleate-induced cells, albeit in reduced numbers compared to wild-type cells . Additionally, high electron-density material was observed in the cytoplasm, likely representing the aggregated DHAS protein in methanol-induced cells .

Comparative Analysis with Other Peroxisomal Membrane Proteins

In Candida boidinii, PMP47A is one of several abundant peroxisomal membrane proteins, including PMP31 and PMP32 . While PMP31 and PMP32 are highly similar to each other (97% identity) and are predicted to span the membrane once or twice, they differ significantly from PMP47A in sequence and likely in function . All of these proteins share the characteristic of being strongly basic, with predicted isoelectric points above 10 .

Research Applications and Methods

Recombinant PMP47A serves as a valuable tool for studying peroxisomal membrane dynamics, protein import mechanisms, and metabolic pathways. The availability of pure recombinant protein facilitates various biochemical and structural analyses, including crystallization attempts, binding assays, and reconstitution studies in artificial membrane systems.

Common applications of recombinant PMP47A include SDS-PAGE analysis, which is used to assess protein purity and molecular weight . The protein may also serve as a standard or control in studies investigating peroxisomal membrane proteins or as an antigen for generating specific antibodies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PMP47A; Peroxisomal membrane protein PMP47A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-423
Protein Length
full length protein
Species
Candida boidinii (Yeast)
Target Names
PMP47A
Target Protein Sequence
MSTREYDDLSHAFAGAGGGLLSMTLTYPLVTLTTHAQTMVKLKKDQEKEKENSNEDGSLS PKSSNTSDVSQKKISQFEILKKILKDQGAKGLYNGLESALFGIAVTNFVYYYFYELTGKT LNRRSNPQTASNSKKVALKKGLSVWQSMAAGAVAGTISRVATNPIWVANTRMTILSKNQG KLGKLNTIEAIIYILKNEGWQKLFTGIVPALFLVLNPIIQYTIFEQLKSFIVKIKKRNIT PVDALLLGAFGKLIATIITYPYITLRSRMHVKSMTEISEDVEKERTDSVQSLPEDGSDED NLKENSAKSPYAETITKIISKLPSPIVSMFTLGYGMYKEEGVSSFYRGLSVKLLQSILNA AFLFYFKEELLILSDGIIKSTKRATGLANNPYNAKDVIHSFEKALSMRSPRTRTTTVASS AKE
Uniprot No.

Target Background

Function
May exhibit transport activity.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.