Recombinant Candida boidinii Peroxisomal membrane protein PMP47B (PMP47B)

Shipped with Ice Packs
In Stock

Description

Introduction to PMP47B and Candida boidinii

Candida boidinii is a methylotrophic yeast capable of utilizing various growth substrates including methanol, oleic acid, and D-alanine, all of which can induce vigorous peroxisomal proliferation. While these diverse substrates activate different peroxisomal metabolic pathways, the peroxisomal membranes contain common abundant peroxisomal membrane proteins (PMPs), including PMP31, PMP32, and PMP47 . The gene encoding PMP47 was previously cloned and analyzed, with subsequent research identifying a second PMP47 gene or allele, termed PMP47B .

PMP47B exhibits remarkable similarity to PMP47A, sharing approximately 95% sequence identity at the amino acid level . Both genes are strongly induced by methanol, oleic acid, and D-alanine, suggesting their importance in adapting peroxisomal function to different metabolic demands . The GenBank Accession Number for PMP47B has been registered as L27998, while PMP47A is registered as J05672 .

Candida boidinii serves as an excellent model organism for studying peroxisomal biogenesis and function due to its adaptable metabolism that requires extensive peroxisomal involvement. The significance of PMP47B in cellular metabolism becomes evident when examining PMP47-deficient strains, which display retarded growth on oleate and complete inability to grow on methanol, both substrates requiring peroxisomal metabolism .

Gene and Protein Structure

Interestingly, protease susceptibility experiments suggest that the topology of PMP47 in the peroxisomal membrane is inverted compared to its mitochondrial counterparts . This distinctive structural arrangement likely relates to its specialized function within the peroxisomal membrane environment.

Biochemical Properties

All abundant peroxisomal membrane proteins in Candida boidinii, including PMP47B, share certain biochemical characteristics. They are basic in charge with predicted isoelectric points above 10 . This high isoelectric point may play a role in their interaction with the peroxisomal membrane and potentially with other peroxisomal proteins.

The following table summarizes key molecular characteristics of PMP47B compared to other peroxisomal membrane proteins in Candida boidinii:

CharacteristicPMP47BPMP47APMP31/PMP32
Amino Acid Length~423~423256
Sequence Identity with PMP47B100%95%Low
Predicted Membrane Spans661-2
Isoelectric Point>10>10>10
GenBank AccessionL27998J05672L27999/L28000
Induction by MethanolStrongStrongStrong
Induction by Oleic AcidStrongStrongStrong
Induction by D-alanineStrongStrongStrong

Transport Function

As a member of the mitochondrial solute transporter family, PMP47B is believed to function primarily as a substrate carrier in the peroxisomal membrane . Research on PMP47-depleted strains suggests that this protein transports an unknown small molecule necessary for the folding or translocation machinery of specific enzymes within peroxisomes .

The critical nature of this transport function is demonstrated by the severe metabolic defects observed in PMP47-deficient strains. When the PMP47 gene is disrupted in Candida boidinii, cells exhibit retarded growth on oleate and complete inability to grow on methanol . Both of these substrates require intact peroxisomal metabolism for proper utilization.

Role in Enzyme Import and Activity

Detailed analysis of PMP47-deficient strains has revealed specific effects on peroxisomal enzymes. In strains lacking PMP47 (pmp47delta), alcohol oxidase (AOD) is present in peroxisomes but is enzymatically inactive . In contrast, dihydroxyacetone synthase (DHAS) remains enzymatically active but is mislocalized to the cytoplasm and nucleus rather than being properly imported into peroxisomes .

These observations have led researchers to propose that PMP47 does not directly catalyze protein folding but instead transports a molecule necessary for the proper folding or translocation machinery within peroxisomes . Since both AOD and DHAS contain the peroxisomal targeting signal 1 (PTS1) motif at their carboxyl termini, these findings suggest that PMP47 depletion can dissect the peroxisomal import pathway specifically for PTS1-containing proteins .

The functional consequences of PMP47 depletion are summarized in the following table:

Growth SubstrateWild-Type GrowthPMP47-Deficient GrowthEffect on Peroxisomal Enzymes
OleateNormalRetardedPartial defects in peroxisomal metabolism
MethanolNormalNo GrowthAOD: In peroxisomes but inactive; DHAS: Active but mislocalized

Critical Regions for Peroxisomal Localization

Analysis of PMP47-dihydrofolate reductase (DHFR) fusion proteins has revealed that amino acids 199-267 are necessary for peroxisomal targeting, although additional sequences may be required for efficient sorting or retention by the organelles . A fusion protein containing amino acids 1-267 of PMP47, which encompasses five of the six predicted membrane spans, demonstrates complete competence for sorting to peroxisomes .

In contrast, fusion proteins containing only amino acids 1-199 (encompassing three membrane spans) or amino acids 268-423 fail to properly target to peroxisomes . This evidence suggests that the region between amino acids 199-267, which includes portions of membrane spans 4 and 5, contains essential information for targeting PMP47B to peroxisomes.

The targeting capabilities of various PMP47 fragments are summarized below:

PMP47 FragmentPeroxisomal Targeting Capability
1-267Complete targeting
1-199No targeting
268-423No targeting
203-420Partial targeting (lower efficiency)
185-267 or 203-267No targeting

Expression Systems

Recombinant production of PMP47B has been achieved using various expression systems. Commercial sources offer the protein produced in different host organisms, including yeast, Escherichia coli, baculovirus-infected insect cells, and mammalian cells . Each expression system provides distinct advantages in terms of protein folding, post-translational modifications, and yield.

Current Research Applications

Recombinant PMP47B has significant applications in various research contexts, primarily focused on understanding peroxisomal biogenesis, membrane protein targeting, and the specific role of PMP47B in peroxisomal metabolism. The availability of recombinant forms of the protein facilitates structural studies, functional assays, and investigations of protein-protein interactions within the peroxisomal membrane.

Unresolved Questions

Despite the progress in understanding PMP47B, several important questions remain unanswered:

  1. What is the precise molecular substrate transported by PMP47B?

  2. How does the unique membrane topology of PMP47B relate to its transport function?

  3. What is the three-dimensional structure of PMP47B, and how does it compare to mitochondrial carrier proteins?

  4. What additional proteins interact with PMP47B to facilitate its function?

  5. What regulatory mechanisms control PMP47B expression in response to different metabolic conditions?

Future Research Directions

Future research on PMP47B will likely focus on resolving its high-resolution structure, identifying its transported substrates through advanced metabolomic approaches, and further elucidating its role in peroxisomal protein import and folding. Additionally, comparative analyses with related proteins in other organisms may provide insights into conserved mechanisms of peroxisomal membrane protein function across species.

The development of improved expression and purification methods for recombinant PMP47B will continue to facilitate these investigations. As our understanding of peroxisomal membrane biology advances, PMP47B remains a critical model for studying membrane protein targeting, integration, and function in this essential organelle.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, serving as a reference point for customers.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PMP47B; Peroxisomal membrane protein PMP47B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-419
Protein Length
full length protein
Species
Candida boidinii (Yeast)
Target Names
PMP47B
Target Protein Sequence
MSSREYDDLSHAFAGAGGGLLSMTLTYPLVTLTTHAQTMVRLKKNEEEEKENSNEDGSLS PKSSNTSNISQKKISQFEILKKILKDQGAKGLYNGLESALFGIAVTNFVYYYFYELTGKT LSRRSNPQTTSGSKKVTLKKGLSVWQSMAAGAVAGTISRVATNPIWVANTRMTILSKNQG KLGKLNTIEAIIYILKNEGWQKLFTGIVPALFLVLNPIIQYTIFEQLKSFIVKIKKRNVT PVDALLLGAFGKLIATIITYPYITLRSRMHVKSMTENNEDSEKERTDSVQSLPEDGSDED NSKENPYAETINKIISKLPSPIVSMFIIGYKMYKEEGVSSFYRGLSVKLLQSILNAAFLF YFKEELLILSDAIIKSTKRVTGLANNPYNAKDVIHSFEKALCMRNPRSRTTTVPQTNEE
Uniprot No.

Target Background

Function
May exhibit transport activity.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is PMP47B and what is its basic structural composition?

PMP47B (Peroxisomal membrane protein 47B) is an integral membrane protein found in the peroxisomes of the methylotrophic yeast Candida boidinii. It consists of 419-423 amino acids and belongs to a family of transport proteins that includes mitochondrial solute transporters . The full-length recombinant protein can be expressed with an N-terminal His tag in E. coli expression systems . The amino acid sequence of PMP47B contains multiple hydrophobic regions that form membrane-spanning domains, consistent with its role as an integral membrane protein .

How does PMP47B differ from other peroxisomal membrane proteins?

PMP47B is unique among peroxisomal proteins as it is the only known peroxisomal member of the mitochondrial solute transporter family . This distinguishes it from other peroxisomal membrane proteins and suggests a specialized role in metabolite transport across the peroxisomal membrane.

Unlike many other peroxisomal proteins that use the PTS1 (Peroxisomal Targeting Signal 1) pathway for import, the targeting of PMP47B to peroxisomes depends on internal sequences rather than its C-terminal region . While PMP47 contains two potential PTS1-like sequences (an internal SKL at residues 320-322 and a C-terminal AKE at residues 421-423), experiments with fusion proteins have shown that neither of these is essential for its targeting to peroxisomes . Instead, the region containing amino acids 1-267, which includes five of the six membrane spans, contains the necessary information for peroxisomal targeting .

What is the physiological role of PMP47B in C. boidinii?

PMP47B appears to function as a transporter in the peroxisomal membrane, facilitating the movement of specific metabolites between the peroxisomal matrix and the cytosol . Research with PMP47 gene disruption strains (pmp47Δ) has revealed critical insights into its physiological role:

The absence of PMP47 results in retarded growth on oleate and complete loss of growth on methanol, both of which are substrates that require peroxisomal metabolism . This growth phenotype indicates that PMP47B plays an essential role in peroxisomal function during the metabolism of these substrates.

Detailed analysis of methanol-induced cells lacking PMP47 showed that dihydroxyacetone synthase (DHAS), a key peroxisomal matrix enzyme, was inactive and formed aggregates in the cytoplasm . Interestingly, other peroxisomal matrix enzymes like alcohol oxidase (AOD) and catalase remained active and correctly localized to peroxisomes . This suggests that PMP47B may transport a small molecule necessary for either the folding or translocation machinery of DHAS within peroxisomes, rather than directly catalyzing DHAS folding .

How does the disruption of PMP47 affect peroxisomal biogenesis and function?

When the PMP47 gene is disrupted in C. boidinii, peroxisomes still form but are reduced in number compared to wild-type cells . This indicates that PMP47B is not essential for peroxisome biogenesis but influences peroxisome abundance and functionality.

The most striking effect of PMP47 disruption is on the activity and localization of specific peroxisomal matrix enzymes. As mentioned, DHAS activity is absent in pmp47Δ strains, and the DHAS protein forms aggregates in the cytoplasm rather than being imported into peroxisomes . This selective effect on DHAS import/folding, while not affecting other PTS1-containing proteins like AOD, suggests that PMP47B has a specific role in the import or maturation pathway of certain peroxisomal proteins .

This selective import defect highlights the complexity of peroxisomal protein import mechanisms and suggests that different peroxisomal matrix proteins may have distinct requirements for proper folding and import, beyond just the presence of a targeting signal .

What are the optimal conditions for expressing recombinant PMP47B protein?

Recombinant PMP47B can be successfully expressed in E. coli with an N-terminal His tag . The expression results in a full-length protein (1-419 amino acids) that can be purified and stored as a lyophilized powder . For optimal handling and storage:

  • The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, addition of 5-50% glycerol (final concentration) is recommended

  • The protein should be aliquoted and stored at -20°C/-80°C

  • Repeated freeze-thaw cycles should be avoided

  • Working aliquots can be stored at 4°C for up to one week

These recommendations ensure the stability and functionality of the recombinant protein for various experimental applications.

How can researchers express PMP47B in heterologous systems for functional studies?

PMP47B has been successfully expressed in heterologous yeast systems, particularly in Hansenula polymorpha (both wild-type and peroxisome-deficient mutants) . When expressing PMP47B in heterologous systems, several factors influence its subcellular localization:

These considerations are crucial for researchers designing expression systems for functional studies of PMP47B in heterologous hosts.

What targeting signals direct PMP47B to peroxisomes?

Unlike many peroxisomal matrix proteins that use the PTS1 or PTS2 targeting signals at their termini, the peroxisomal targeting information for PMP47B resides within internal regions of the protein . Analysis using PMP47-dihydrofolate reductase (DHFR) fusion proteins has revealed:

  • Amino acids 1-199 (containing the first three putative membrane spans) do not contain sufficient targeting information

  • A fusion containing amino acids 1-267 (encompassing five membrane spans) is fully competent for sorting to peroxisomes

  • The region between amino acids 203-267 appears to contain critical targeting information, though it sorts with lower efficiency than larger constructs

  • Neither the internal SKL sequence (residues 320-322) nor the C-terminal AKE (residues 421-423) is necessary for peroxisomal targeting

These findings indicate that the targeting of peroxisomal membrane proteins like PMP47B involves recognition of internal sequences, likely within the context of the protein's membrane topology, rather than simple linear targeting sequences as seen with matrix proteins.

How can researchers experimentally determine the membrane topology of PMP47B?

Determining the membrane topology of PMP47B is crucial for understanding its function as a transporter. Several experimental approaches have been used:

  • Protease susceptibility assays: By treating isolated peroxisomes with proteases, researchers can determine which portions of the protein are exposed on the cytosolic face of the membrane (and thus accessible to proteases) versus those protected within the peroxisomal lumen . These experiments have shown that PMP47's topology is inverted compared to mitochondrial carrier proteins .

  • Fusion protein analysis: Creating fusion proteins with reporter domains (like DHFR) at different positions and analyzing their protease susceptibility can help map the orientation of different protein segments .

  • Immunolocalization with epitope tags: By introducing epitope tags at various positions in the protein and using antibodies against these tags, researchers can determine which portions are accessible in intact versus permeabilized organelles.

  • Fluorescence microscopy of GFP fusions: Creating GFP fusion proteins and analyzing their localization can provide insights into targeting determinants and membrane integration.

When designing such experiments, researchers should consider that overexpression might lead to mistargeting to mitochondria, potentially complicating the interpretation of results .

How can PMP47B be used as a tool to study peroxisomal protein import pathways?

PMP47B provides a unique tool for studying the complexity of peroxisomal protein import mechanisms due to several notable characteristics:

  • Dissection of import pathways: The observation that PMP47 disruption selectively affects DHAS import/folding while not affecting other PTS1-containing proteins like AOD indicates that PMP47B can be used to dissect different aspects of the PTS1 import pathway . This selective effect suggests that different matrix proteins may have distinct requirements for proper import and maturation.

  • Investigation of membrane protein targeting: As a membrane protein with internal targeting signals rather than canonical PTS sequences, PMP47B can be used to study the less-understood mechanisms of membrane protein import into peroxisomes .

  • Metabolite transport studies: Since PMP47B likely functions as a transporter for specific metabolites required for protein folding or enzyme activity, it can be used to investigate the role of metabolite exchange in peroxisome function .

Experimental approaches might include creating chimeric proteins between PMP47B and other transporters, systematic mutagenesis of the protein to identify functional domains, or using PMP47B as a marker in genetic screens for peroxisome biogenesis factors.

What methodological approaches can be used to identify the substrates transported by PMP47B?

Identifying the specific substrates transported by PMP47B is crucial for understanding its functional role. Several methodological approaches can be employed:

  • Genetic screening: Analyzing suppressors of the pmp47Δ phenotype might identify genes involved in alternative transport pathways or metabolic bypasses, providing clues about the transported substrate .

  • Metabolomic analysis: Comparing the metabolite profiles of wild-type and pmp47Δ cells could reveal accumulation or depletion of specific metabolites, indicating potential transport substrates.

  • In vitro transport assays: Reconstituting purified PMP47B into liposomes and testing transport of radioactively labeled candidate metabolites can directly measure transport activity.

  • Structural modeling and docking simulations: Using homology modeling based on related transporters and performing in silico docking studies with potential substrates can generate hypotheses for experimental testing.

  • DHAS folding assays: Since PMP47B appears necessary for DHAS activity, developing assays to monitor DHAS folding in the presence of different metabolites might identify the crucial substrate that PMP47B transports .

The fact that PMP47 disruption specifically affects DHAS activity suggests that the transported substrate may be particularly important for this enzyme's folding or activity .

How is PMP47B expression regulated in response to different carbon sources?

The expression of PMP47B in C. boidinii is regulated in response to different carbon sources and metabolic conditions:

  • Methanol induction: The PMP47 promoter (P(PMP47)) is methanol-inducible, leading to increased expression when cells are grown on methanol as a carbon source .

  • Oleate induction: P(PMP47) is also highly induced by oleate, suggesting a role for PMP47B in both methanol and fatty acid metabolism .

  • Temporal regulation: Analysis of induction kinetics has revealed that methanol induces the expression of PMP47 earlier than the expression of matrix enzymes like dihydroxyacetone synthase (DHAS), indicating a programmed sequence of peroxisomal protein expression .

This temporal regulation makes biological sense, as membrane proteins like PMP47B would need to be in place before matrix enzymes are imported. The dual regulation by both methanol and oleate suggests that PMP47B plays roles in multiple peroxisomal metabolic pathways.

What experimental approaches can be used to study the promoter activity and regulation of PMP47B?

Several experimental approaches can be used to study the promoter activity and regulation of the PMP47 gene:

  • Reporter gene assays: The study described in search result used the acid phosphatase gene of Saccharomyces cerevisiae (ScPHO5) as a reporter to evaluate promoter strength and regulation . Similar approaches with other reporters like GFP or luciferase could provide quantitative and real-time information about promoter activity.

  • Promoter truncation and mutation analysis: Creating a series of promoter truncations or targeted mutations can help identify specific regulatory elements responsible for responses to different carbon sources.

  • Chromatin immunoprecipitation (ChIP): Identifying transcription factors that bind to the PMP47 promoter under different conditions can elucidate the regulatory network controlling its expression.

  • Comparative genomics: Comparing the promoter regions of PMP47 and related genes across different yeast species can identify conserved regulatory elements.

When studying PMP47B regulation, it's important to compare it with other peroxisomal proteins. For example, search result evaluated five methanol-inducible promoters (P(AOD1), P(DAS1), P(FDH1), P(PMP20), and P(PMP47)) and found distinct regulatory patterns . This comparative approach provides context for understanding the specific regulation of PMP47B within the broader program of peroxisomal biogenesis.

What are the recommended protocols for isolating and purifying recombinant PMP47B?

Based on the available information, the following protocol can be used for handling recombinant PMP47B:

  • Expression system: Express full-length PMP47B (1-419aa) with an N-terminal His tag in E. coli .

  • Purification: Use affinity chromatography with Ni-NTA or similar matrices to purify the His-tagged protein.

  • Quality control: Confirm purity using SDS-PAGE (should be greater than 90% pure) .

  • Storage preparation:

    • Lyophilize the purified protein

    • Prior to opening, briefly centrifuge the vial to bring contents to the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

  • Working conditions:

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

This protocol ensures the stability and functionality of recombinant PMP47B for experimental applications.

What methods can be used to analyze PMP47B interaction with other peroxisomal proteins?

Several methods can be employed to study the interactions between PMP47B and other peroxisomal proteins:

  • Co-immunoprecipitation (Co-IP): Using antibodies against PMP47B or epitope-tagged versions of the protein to pull down interacting partners, followed by mass spectrometry identification.

  • Yeast two-hybrid (Y2H) assays: Testing direct interactions between PMP47B domains and candidate interacting proteins, though care must be taken with membrane proteins in Y2H systems.

  • Split-GFP complementation: Fusing complementary fragments of GFP to PMP47B and potential interacting partners to visualize interactions in vivo through fluorescence reconstitution.

  • Proximity labeling methods: Using techniques like BioID or APEX2, where PMP47B is fused to a proximity-dependent labeling enzyme that tags nearby proteins for subsequent identification.

  • Genetic interaction screens: Identifying synthetic lethal or synthetic sick interactions between pmp47Δ and mutations in other genes can reveal functional relationships.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify proteins in close proximity to PMP47B in native peroxisomes.

When analyzing interactions, researchers should consider that PMP47B primarily affects DHAS activity and localization, suggesting specific interactions with components of the DHAS import or folding machinery .

How does PMP47B compare to mammalian peroxisomal transporters, and what are the implications for peroxisomal disorders?

While the search results don't directly address the relationship between PMP47B and mammalian peroxisomal transporters, we can infer some comparative aspects:

  • Evolutionary relationships: As PMP47B belongs to the mitochondrial carrier protein family , it likely shares structural and functional similarities with mammalian transporters of this family that might be present in peroxisomes.

  • Functional parallels: The role of PMP47B in supporting the activity of specific peroxisomal matrix enzymes suggests that similar transporters in mammals might be critical for the function of specific peroxisomal pathways.

  • Pathological implications: Many peroxisomal disorders in humans result from defects in peroxisomal protein import or metabolite transport. Understanding the role of transporters like PMP47B in model organisms could provide insights into the molecular basis of these disorders.

  • Therapeutic potential: If mammalian homologs of PMP47B are identified and linked to peroxisomal disorders, they could become targets for therapeutic interventions or serve as biomarkers.

Research seeking to identify mammalian counterparts to PMP47B would need to consider both sequence similarity and functional characteristics, particularly the ability to transport metabolites necessary for the folding or activity of specific peroxisomal enzymes.

How can comparative studies of PMP47B across different yeast species advance our understanding of peroxisome evolution?

Comparative studies of PMP47B across different yeast species can provide valuable insights into peroxisome evolution:

  • Sequence conservation: Analyzing the sequence conservation of PMP47B homologs across methylotrophic yeasts (like C. boidinii and H. polymorpha) and non-methylotrophic yeasts (like S. cerevisiae) can reveal functionally critical domains.

  • Functional adaptation: The regulation of PMP47B by both methanol and oleate suggests adaptation to different metabolic niches. Comparing its regulation and function across species with different metabolic capabilities could reveal how peroxisomal transport systems have evolved.

  • Targeting mechanisms: The unique internal targeting signals of PMP47B can be compared across species to understand the evolution of peroxisomal membrane protein targeting pathways.

  • Expression patterns: The observed temporal regulation where PMP47 expression precedes matrix enzymes can be compared across species to understand the conservation of peroxisome assembly programs.

Experimental approaches might include heterologous expression studies (as done with C. boidinii PMP47B in H. polymorpha ), comparative genomics, and analysis of synthetic genetic interactions in different yeast systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.