Recombinant Candida dubliniensis Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM11; CD36_80770; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Target Names
AIM11
Target Protein Sequence
MTDLLHKLNFKIADASPEYKQRRKIQMIRFFTASAVTIFASRFAYRATVSRQYIPTLFQG NHSPPLSYNFTTDAAVAVGTGTLLCGSVTGMTVFGLCWILDVSNIQEFGWRMKSMLGGWE SEKKLSEAPMDEESSYIQDSLNDILDGKYDFEEDTEEVHTAEMKTK
Uniprot No.

Target Background

Database Links
Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Candida dubliniensis and how does it differ from Candida albicans?

Candida dubliniensis is a recently described species of chlamydospore- and germ tube-positive yeast primarily recovered from oral cavities of HIV-infected individuals and AIDS patients. While closely related to C. albicans, C. dubliniensis shows reduced virulence and pathogenicity. Key differences include:

  • C. dubliniensis has been recovered from 27% of HIV-infected individuals and 32% of AIDS patients with oral candidiasis symptoms, compared to the more prevalent C. albicans

  • Unlike C. albicans, C. dubliniensis shows limited ability to form hyphae under most laboratory conditions

  • C. dubliniensis possesses a more restricted repertoire of virulence factors, lacking key hypha-specific virulence factors such as Hyr1, Als3, and some secreted aspartyl proteinase (SAP) family members

  • Comparative genomic analyses reveal 168 C. albicans-specific genes absent in C. dubliniensis, while C. dubliniensis has 115 confirmed pseudogenes, indicating ongoing gene loss

What are mitochondrial inheritance proteins in Candida species?

Mitochondrial inheritance proteins in Candida species are specialized molecules that regulate mitochondrial genome maintenance, replication, and transmission during cell division. These proteins play crucial roles in:

  • Maintaining mitochondrial DNA integrity and proper segregation during cell division

  • Regulating the large inverted repeats (LIRs) found in C. dubliniensis mitochondrial genomes that can generate genome isomers through flip-flop recombination

  • Facilitating the interconversion between circular- and linear-mapping mitochondrial genome forms

  • Controlling respiratory functions through electron transport chain complexes

The AIM (Altered Inheritance of Mitochondria) family of proteins specifically regulates these processes, with different members (e.g., AIM36) performing specialized functions within mitochondrial maintenance pathways .

What experimental systems are used to study recombinant mitochondrial proteins in Candida dubliniensis?

Researchers employ several experimental systems to investigate recombinant mitochondrial proteins in C. dubliniensis:

Experimental SystemApplicationsKey Advantages
E. coli expression systemsProduction of His-tagged recombinant proteins for biochemical analysisHigh yield, simplified purification protocols
Reconstituted human oral epithelium (RHE)Comparative analysis of gene expression between C. albicans and C. dubliniensisMimics host-pathogen interface in controlled conditions
Deletion mutant collectionsFunctional analysis of transcription regulators and mitochondrial proteinsAllows precise phenotypic characterization
Genomic DNA sequencingIdentification of species-specific genes and mitochondrial genome architectureEnables comprehensive comparative genomics

For recombinant protein production, the standard approach involves expressing the target gene in E. coli with an N-terminal His-tag, followed by purification using metal affinity chromatography and functional characterization through biochemical assays .

How are mitochondrial proteins from C. dubliniensis functionally characterized?

Functional characterization of C. dubliniensis mitochondrial proteins involves multiple complementary approaches:

  • Biochemical assays: Assessment of NADH ubiquinone oxidoreductase Complex I (CI) activity through spectrophotometric methods measuring electron transfer rates and oxygen consumption

  • Genetic manipulation: Creation of deletion mutants through CRISPR-Cas9 or traditional homologous recombination approaches to observe phenotypic consequences

  • Growth assays on alternative carbon sources: Testing strain fitness on non-fermentable carbon sources (glycerol, ethanol) to evaluate respiratory capacity

  • Filamentation profiling: Quantitative analysis of hyphal formation under various conditions to link mitochondrial function to morphogenesis

  • 3D protein modeling: Computational structural analysis to identify functional domains, especially evolutionarily acquired stretches of amino acids that distinguish Candida-specific proteins

For example, experiments with C. albicans NDU1 (a mitochondrial protein regulating Complex I) demonstrated that biochemical assays of respiratory function combined with virulence studies provide a comprehensive assessment of mitochondrial protein roles in pathogenicity .

What protocols exist for isolating pure mitochondrial fractions from Candida dubliniensis?

Isolation of pure mitochondrial fractions from C. dubliniensis requires careful execution of the following protocol:

  • Cell wall digestion: Treat cells with zymolyase in sorbitol buffer (1.2M sorbitol, 50mM Tris-HCl pH 7.5, 10mM MgCl₂, 1mM DTT) at 30°C until >80% spheroplast formation is achieved

  • Gentle lysis: Homogenize spheroplasts using a Dounce homogenizer in isolation buffer (0.6M sorbitol, 10mM Tris-HCl pH 7.4, 1mM EDTA, 1mM PMSF, protease inhibitor cocktail)

  • Differential centrifugation:

    • Clear cellular debris at 1,500g for 5 minutes

    • Collect crude mitochondria at 12,000g for 15 minutes

    • Purify through sucrose gradient ultracentrifugation (20-60% gradient) at 100,000g for 1 hour

  • Verification of mitochondrial purity:

    • Western blot analysis using antibodies against mitochondrial markers (e.g., cytochrome c oxidase)

    • Enzyme activity assays for mitochondrial-specific and non-mitochondrial enzymes

    • Electron microscopy to confirm mitochondrial morphology

This protocol achieves >95% pure mitochondrial fractions with preserved functional integrity, allowing for subsequent proteomic analysis and functional studies of mitochondrial proteins .

What expression systems yield the highest functional recombinant mitochondrial proteins from C. dubliniensis?

Comparison of expression systems for C. dubliniensis mitochondrial proteins reveals system-specific advantages:

Expression SystemProtein YieldFunctional QualityBest Applications
E. coli BL21(DE3)High (10-50 mg/L)ModerateBasic biochemical analysis, antibody production
E. coli C41(DE3)/C43(DE3)Moderate (5-15 mg/L)GoodMembrane-associated mitochondrial proteins
Pichia pastorisModerate (10-30 mg/L)ExcellentProteins requiring eukaryotic processing
Baculovirus/insect cellsLow-moderate (2-10 mg/L)ExcellentComplex multidomain proteins
Homologous expressionLow (0.5-3 mg/L)OptimalFunctionally sensitive proteins

The E. coli system is preferred for basic structural studies due to higher yields, while the Pichia pastoris system often provides better functional quality for mitochondrial proteins. For AIM36 protein specifically, expression in E. coli with fusion to an N-terminal His-tag produces functionally active protein when expressed at lower temperatures (16-18°C) overnight with 0.1-0.5mM IPTG induction .

Recommended purification involves immobilized metal affinity chromatography followed by size exclusion chromatography in buffers containing 6% trehalose for stability enhancement .

How do mitochondrial gene arrangements in C. dubliniensis compare to other Candida species, and what implications does this have for protein function?

C. dubliniensis exhibits distinct mitochondrial genome organization compared to related Candida species:

  • Genome isomers: C. dubliniensis possesses circular-mapping genome isomers generated through large inverted repeats (LIRs) that undergo flip-flop recombination

  • Intron content: Comparative analysis reveals species-specific patterns of introns within mitochondrial genes in C. dubliniensis versus other Candida species, as shown in the table below:

Mitochondrial GeneC. dubliniensisC. albicansC. maltosaC. sojae
cob1-2 introns1-2 introns2 introns (bI1, bI2)No introns
cox12-3 introns2-3 introns1 intron (aI1)2 introns (aI1, aII1)
nad50-1 introns0-1 intronsNo intronsNo introns
rnl1 intron1 intron2 introns (rI1, rI2)No introns
  • Arrangement of LIRs: While species like C. maltosa, C. neerlandica and C. sojae contain simple LIRs generating two isomers, C. dubliniensis has evolved specific LIR arrangements that serve as resolution elements allowing interconversion between circular- and linear-mapping genome forms

These mitochondrial genomic features directly impact protein function through:

  • Altered transcriptional regulation of mitochondrial genes

  • Potential differences in RNA processing and maturation

  • Differential regulation of electron transport chain components

  • Species-specific patterns of mitochondrial protein assembly and function

The unique genomic architecture suggests why some mitochondrial functions may differ between C. dubliniensis and the more virulent C. albicans .

What role do mitochondrial proteins play in the reduced virulence of C. dubliniensis compared to C. albicans?

Mitochondrial proteins contribute significantly to the reduced virulence of C. dubliniensis compared to C. albicans through several mechanisms:

  • Respiratory metabolism differences: C. dubliniensis mitochondrial proteins show altered activity patterns in the electron transport chain, particularly in Complex I, affecting energy production during infection

  • Hyphal morphogenesis regulation: Mitochondrial function is tightly linked to filamentation capability, with C. dubliniensis showing limited hyphal development compared to C. albicans. This difference involves mitochondrial proteins that fail to activate in response to host conditions

  • Stress response modulation: The two-component signaling systems in mitochondria that regulate oxidative stress responses are differently regulated in C. dubliniensis, affecting survival within phagocytic cells

  • Apoptotic pathway control: Mitochondrial proteins in C. dubliniensis, including those in the AIM family, show differential regulation of programmed cell death pathways compared to C. albicans

Comparative studies in reconstituted human oral epithelium (RHE) demonstrate that C. albicans rapidly upregulates hypha-specific and virulence genes within 30 minutes of tissue contact, while C. dubliniensis fails to activate similar pathways due to altered mitochondrial signaling, resulting in significantly reduced tissue damage (measured by LDH release) .

What methodological approaches can address the challenges in resolving contradictory findings about mitochondrial protein functions in C. dubliniensis?

Resolving contradictory findings regarding mitochondrial protein functions in C. dubliniensis requires a multifaceted approach:

  • Standardization of experimental conditions:

    • Carefully document media composition, temperature, pH, and oxygen levels

    • Establish consensus growth protocols across laboratories

    • Create strain repositories with verified genotypes

  • Multi-omics integration:

    • Combine proteomic, transcriptomic, and metabolomic datasets

    • Develop computational models to integrate seemingly contradictory results

    • Apply machine learning algorithms to identify hidden patterns across diverse datasets

  • In vivo validation:

    • Test contradictory findings in animal models

    • Utilize ex vivo human tissue models to validate in vitro results

    • Employ clinical isolates alongside laboratory strains

  • Genetic complementation strategies:

    • Perform cross-species complementation experiments

    • Engineer chimeric proteins to identify functional domains

    • Apply conditional expression systems to study essential genes

  • Time-resolved experimental design:

    • Conduct temporal studies to capture dynamic protein functions

    • Implement single-cell analysis to account for population heterogeneity

    • Develop biosensors to monitor mitochondrial function in real-time

When applied to contradictory findings about C. dubliniensis metabolic adaptations, this approach successfully reconciled opposing results by revealing condition-specific regulation patterns in mitochondrial protein expression .

How can evolutionary analysis of mitochondrial proteins inform therapeutic strategies against Candida infections?

Evolutionary analysis of mitochondrial proteins offers promising avenues for therapeutic development against Candida infections:

  • Targeting species-specific domains: Phylogenetic analysis of mitochondrial proteins like NDU1 has identified three evolutionarily acquired stretches of amino acid inserts present only in a small number of ascomycete fungi including Candida species . These unique domains represent potential targets for selective antifungal development.

  • Exploiting functional divergence: Comparative genomics between C. dubliniensis and C. albicans reveals differential evolution of mitochondrial respiratory components, providing opportunities to target pathogen-specific pathways without affecting human mitochondria .

  • Leveraging natural variation: Analysis of mitochondrial genome structure across Candida isolates from different patient populations can identify conserved versus variable regions to inform drug targeting:

Evolutionary FeatureTherapeutic PotentialResearch Approach
Species-specific amino acid insertsHigh (exclusive targets)Structure-guided drug design
Diverged functional domainsModerate to highActivity-based screening
Variable regions between clinical isolatesLow (resistance concerns)Population genomics
Conserved catalytic coresVariable (selectivity challenges)Computational modeling
  • Predictive resistance modeling: Evolutionary rate analysis can identify mitochondrial proteins under selection pressure, predicting potential resistance mechanisms before they emerge clinically. For example, the rapid development of fluconazole resistance seen in C. dubliniensis (2.5% of isolates) suggests evolutionary adaptation involving mitochondrial metabolism .

This evolutionary approach has already identified the involvement of specific transcription regulators (e.g., Bcr1, Ash1) that show significantly different roles in filamentation between C. dubliniensis and C. albicans, suggesting novel therapeutic targets .

What methodological innovations could improve the study of mitochondrial protein interactions in Candida dubliniensis biofilms?

Innovative methodologies for studying mitochondrial protein interactions in C. dubliniensis biofilms include:

  • Live-cell proximity labeling:

    • Implementation of APEX2 or BioID techniques to identify protein-protein interactions within intact biofilms

    • Adaptation of split-protein complementation assays for biofilm-specific interactions

    • Development of biofilm-penetrating fluorescent probes for in situ visualization

  • Microfluidic biofilm systems:

    • Creation of gradient-generating devices to study spatial protein distribution

    • Integration of oxygen sensors to correlate respiratory activity with biofilm structure

    • Implementation of flow cells with real-time imaging capabilities

  • Single-cell '-omics' within biofilms:

    • Application of laser capture microdissection coupled with proteomics

    • Development of in situ transcriptomics to capture spatial gene expression

    • Implementation of metabolic flux analysis at different biofilm depths

  • Computational modeling integration:

    • Creation of multi-scale models linking protein interactions to biofilm architecture

    • Development of predictive algorithms for biofilm formation based on mitochondrial protein activity

    • Implementation of network analysis to identify key regulatory hubs

These methodological innovations could help resolve the paradox observed with NDU1 (a mitochondrial protein controlling biofilm formation) in C. albicans, where it affects both biofilm dispersal and attachment processes through respiratory regulation . Similar studies in C. dubliniensis could identify species-specific mitochondrial control of biofilm dynamics.

How does the genomic context of mitochondrial protein genes influence their expression and function in different clinical isolates of C. dubliniensis?

The genomic context surrounding mitochondrial protein genes significantly impacts their expression and function across clinical isolates of C. dubliniensis:

  • Promoter variations: Clinical isolates show polymorphisms in promoter regions of mitochondrial protein genes, affecting transcription factor binding and expression levels. For example, a nine-year prospective study of 368 C. dubliniensis isolates revealed genotype-specific variations in mitochondrial gene expression patterns .

  • Chromosome rearrangements: Larger genomic reorganizations can alter the regulation of mitochondrial protein genes through:

    • Position effects (proximity to telomeres/centromeres)

    • Disruption or creation of long-range enhancer interactions

    • Changes in chromatin organization affecting gene accessibility

  • Intergenic region variability: Analysis of intergenic regions reveals insertions/deletions that modify:

    • Transcription factor binding sites

    • Small regulatory RNA expression

    • DNA methylation patterns

  • Mitochondrial DNA heteroplasmy: Clinical isolates show variations in:

    • Ratio between different mitochondrial genome isomers

    • Copy number of mitochondrial DNA

    • Presence/absence of optional introns in key respiratory genes

The combined effect of these genomic context variations explains the observed phenotypic diversity in C. dubliniensis clinical isolates, particularly regarding filamentation capability, biofilm formation, and antifungal drug susceptibility . For instance, a specific bloodstream isolate of C. dubliniensis genotype 4 showed increased minimum inhibitory concentration to 5-flucytosine (>32 µg/ml), correlating with unique genomic arrangements affecting mitochondrial function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.