Recombinant Candida dubliniensis Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

What is AIM31 protein in Candida dubliniensis and what is its function?

AIM31 (also known as RCF1) is a mitochondrial protein originally discovered in a genetic screen designed to identify proteins whose absence caused altered inheritance of mitochondrial DNA (AIM) . The protein plays a crucial role in mitochondrial function, specifically in the cytochrome bc1-COX supercomplex where it appears to bind to both the cytochrome bc1 and COX enzyme domains . This association suggests AIM31 is involved in the respiratory chain and energy production in C. dubliniensis. The protein is 155 amino acids in length with the following sequence: MSVRLPSSMSYGEEEEPDVLQKMWEKSKQQPFVPLGSLLTAGAVLLAARSMKRGEKLKTQRYFRYRIGFQLATLVALVGGGFYYGTETSEHKQIREDKLREKAKQREKLWIEELERRDSIIQARKQRLEESKKELRELAKQGFIEEKESNDEKED .

How does C. dubliniensis AIM31 differ from its homologs in other Candida species?

C. dubliniensis AIM31 shares significant sequence homology with C. albicans AIM31/RCF1, but has distinct sequence variations. The C. albicans version (UniProt ID: C4YRP9) is also 155 amino acids in length with the sequence: MSVRLPSSMSYGEEEEPDVLQKMWDKSKQQPFVPLGSLLTAGAVLLAARSMKRGEKLKTQRYFRYRIGFQLATLVALVGGGFYYGTETSQHKQTREDKLREKAKQREKLWIEELERRDAIIQARKQRLEESKKELRELAKQGFIEEKESNDKKED . Key differences include amino acid substitutions at several positions (e.g., W→E at position 32, T→I at position 96, and K→D at position 153), which may contribute to species-specific functions. These differences are likely significant because C. dubliniensis and C. albicans differ in their epidemiology, virulence characteristics, and ability to develop antifungal resistance .

What experimental systems are suitable for studying AIM31 function?

Several experimental systems have been validated for AIM31 research:

• Gene deletion studies: Using targeted gene deletion methods like the MPA(R)-flipping strategy to create ura3 mutants is effective in C. dubliniensis .

• Reporter gene fusion: The URA3 gene from C. albicans can be used as a selection marker for targeted integration of reporter gene fusions to study AIM31 expression .

• Recombinant protein expression: AIM31 can be successfully expressed in E. coli with N-terminal His tags for protein-level studies .

• Mitochondrial isolation: For studying AIM31's role in mitochondrial complexes, isolation of intact mitochondria and blue native gel electrophoresis (BN-PAGE) can be employed to maintain supercomplex integrity .

What are the optimal conditions for recombinant expression of C. dubliniensis AIM31?

For optimal recombinant expression of C. dubliniensis AIM31:

• Expression system: E. coli has been successfully used as a heterologous expression system .

• Construct design:

  • Full-length mature protein (amino acids 1-155)

  • N-terminal His-tag for purification

  • Codon optimization for E. coli may improve yields

• Purification conditions:

  • IMAC (immobilized metal affinity chromatography) using the His-tag

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Protein is typically obtained as a lyophilized powder

• Reconstitution protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Aliquot and store at -20°C/-80°C

Note: Repeated freeze-thaw cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

How can I genetically manipulate AIM31 in C. dubliniensis for functional studies?

For genetic manipulation of AIM31 in C. dubliniensis, the following methodologies have proven effective:

• Isogenic strain construction:

  • Generate homozygous ura3 mutants from wild-type C. dubliniensis using targeted gene deletion

  • Sequentially inactivate URA3 alleles using the MPA(R)-flipping strategy

  • This strategy uses mycophenolic acid resistance marker followed by site-specific FLP-mediated recombination

• Gene targeting approaches:

  • Use C. albicans URA3 (CaURA3) as a selection marker for targeted integration

  • Design constructs with homology regions flanking the target site

  • For fusion constructs, the C. dubliniensis AIM31 promoter can be fused to reporter genes like GFP

• Verification strategies:

  • PCR verification of correct integration

  • Testing for uridine prototrophy

  • Fluorescence detection for reporter constructs

• Alternative strategy for C. dubliniensis:

  • Auxotrophic markers for histidine, leucine, and arginine biosynthesis genes have been developed

  • These markers are dispensable for infection models and allow for multiple genetic manipulations

What methods are recommended for analyzing AIM31's role in mitochondrial function?

To analyze AIM31's role in mitochondrial function, the following methodological approaches are recommended:

• Mitochondrial isolation and fractionation:

  • Isolate intact mitochondria using differential centrifugation

  • Maintain protein complex integrity using mild detergents like digitonin

  • Perform subfractionation to separate outer membrane, inner membrane, and matrix components

• Protein complex analysis:

  • Blue native gel electrophoresis (BN-PAGE) to preserve supercomplex integrity

  • Identify AIM31-containing complexes using mass spectrometry

  • Immunoprecipitation with tagged AIM31 to identify interaction partners

• Functional assays:

  • Oxygen consumption measurements to assess respiratory chain function

  • Membrane potential measurements using fluorescent dyes

  • ATP synthesis assays to evaluate oxidative phosphorylation efficiency

  • ROS production assays to assess mitochondrial stress

• Genetic complementation:

  • AIM31 deletion and subsequent complementation with wild-type or mutant alleles

  • Cross-species complementation (e.g., with C. albicans AIM31) to assess functional conservation

How does AIM31 contribute to mitochondrial inheritance and mitochondrial DNA stability?

AIM31's role in mitochondrial inheritance and mtDNA stability can be analyzed through several advanced approaches:

• Mitochondrial genome stability assessment:

  • Quantitative PCR to measure mtDNA copy number in AIM31 mutants

  • Long-range PCR to detect large-scale deletions in mtDNA

  • Next-generation sequencing to identify mutation patterns in mtDNA

• Mitochondrial segregation analysis:

  • Fluorescent labeling of mitochondria to track inheritance patterns during cell division

  • Time-lapse microscopy to monitor mitochondrial distribution in real-time

  • Quantitative analysis of mitochondrial network morphology and dynamics

• Molecular mechanisms:

  • AIM31 appears to be involved in the cytochrome bc1-COX supercomplex, where it interacts closely with the Cox3 protein

  • This association may influence respiratory chain function, which indirectly affects mtDNA stability through regulation of ROS production

  • The protein's transmembrane domains suggest it may bridge mitochondrial membranes, potentially influencing mtDNA nucleoid positioning

• Comparative analysis:

  • Studies in related species reveal that AIM31/RCF1 shares functional overlap with another mitochondrial protein (AIM38/RCF2)

  • These proteins may independently bind to the cytochrome bc1-COX supercomplex, providing redundancy in function

What is known about AIM31's role in C. dubliniensis pathogenicity and antifungal resistance?

The relationship between AIM31 and C. dubliniensis pathogenicity/antifungal resistance is an emerging area of research:

• Context of C. dubliniensis pathogenicity:

  • C. dubliniensis is an opportunistic fungal pathogen closely related to C. albicans

  • It differs from C. albicans in epidemiology, virulence characteristics, and ability to develop fluconazole resistance in vitro

  • C. dubliniensis has been implicated in oral candidiasis in HIV-positive individuals and has also been recovered from HIV-negative persons with oral candidiasis

  • The first cases of C. dubliniensis fungemia in North America were reported in immunocompromised patients

• Mitochondria and antifungal resistance connection:

  • Mitochondrial function has been linked to antifungal drug resistance in Candida species

  • Changes in respiratory capacity can affect cellular responses to azole antifungals

  • Longitudinal studies show that C. dubliniensis isolates can acquire itraconazole resistance (even without prior azole exposure)

  • Approximately 8% of clinical isolates exhibited itraconazole resistance in one study

• Potential AIM31 mechanisms in resistance:

  • As a component of respiratory complexes, AIM31 may influence membrane potential and drug efflux

  • Changes in mitochondrial function can alter cellular metabolic states, potentially affecting drug susceptibility

  • Research suggests connections between mitochondrial proteins and efflux pumps like MDR1, which can be induced by drugs such as benomyl

• Research approaches:

  • Comparing AIM31 expression levels between susceptible and resistant isolates

  • Evaluating mitochondrial function in clinical isolates with different resistance profiles

  • Testing whether AIM31 deletion affects susceptibility to various antifungal classes

How does C. dubliniensis AIM31 interact with other mitochondrial proteins in respiratory chain supercomplexes?

Understanding AIM31's interactions in respiratory chain supercomplexes requires sophisticated approaches:

• Protein-protein interaction studies:

  • Affinity purification using His-tagged cytochrome c1 and Aac2 derivatives has been successful for isolating the cytochrome bc1-COX-AAC supercomplex under mild digitonin solubilization conditions

  • Mass spectrometry analysis can identify components co-purifying with AIM31

  • Chemical crosslinking coupled with mass spectrometry can capture direct interaction interfaces

• Structural insights:

  • AIM31/RCF1 displays a close physical relationship with the Cox3 protein in the COX complex

  • The protein appears to bind to both the cytochrome bc1 and COX enzyme domains, suggesting a bridging function

  • Cryo-electron microscopy could reveal the precise positioning of AIM31 within these supercomplexes

• Functional relationships:

  • AIM31/RCF1 shares an overlapping function with AIM38/RCF2, another mitochondrial protein with limited similarity to AIM31

  • These proteins may independently bind to the cytochrome bc1-COX supercomplex, providing functional redundancy

  • Double deletion studies can reveal synergistic effects that single deletions might mask

• Evolutionary conservation:

  • Comparative analysis across Candida species reveals that AIM31 belongs to the Hig1 protein family

  • Conservation of function across species can be tested through heterologous expression and complementation studies

What are common challenges in working with recombinant C. dubliniensis AIM31 and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant AIM31:

• Protein solubility issues:

  • Problem: AIM31 contains hydrophobic transmembrane domains that may cause aggregation

  • Solution: Use mild detergents (e.g., digitonin, DDM) during extraction; optimize buffer conditions with stabilizing agents like trehalose (6%) as used in commercial preparations

• Protein stability concerns:

  • Problem: Recombinant AIM31 may show reduced stability during storage

  • Solution: Store as lyophilized powder; after reconstitution, add glycerol (recommended 50% final concentration) and store at -20°C/-80°C; avoid repeated freeze-thaw cycles

• Low expression yields:

  • Problem: Mitochondrial membrane proteins often express poorly in heterologous systems

  • Solution: Optimize codon usage for expression host; try fusion tags known to enhance solubility (e.g., MBP, SUMO); test different expression temperatures (16-30°C)

• Functional activity verification:

  • Problem: Confirming that recombinant AIM31 retains native activity

  • Solution: Develop functional reconstitution assays with isolated mitochondrial membranes; compare activity with native protein; verify proper folding using circular dichroism

• Antibody specificity issues:

  • Problem: Cross-reactivity with related proteins (e.g., C. albicans AIM31)

  • Solution: Generate antibodies against unique epitopes; validate specificity against knockout strains; use epitope-tagged versions for detection

How can I differentiate between direct and indirect effects of AIM31 manipulation in experimental studies?

Distinguishing direct from indirect effects requires careful experimental design:

• Conditional expression systems:

  • Implement tetracycline-regulatable or other inducible systems for AIM31

  • Monitor time-dependent changes after AIM31 depletion or induction

  • Immediate effects (hours) are more likely to be direct than delayed effects (days)

• Domain-specific mutations:

  • Design point mutations in specific functional domains rather than complete deletion

  • Compare phenotypes of different domain mutants to map function-specific effects

  • Use structure-guided mutagenesis targeting interaction interfaces

• Complementation strategies:

  • Rescue experiments with wild-type AIM31 should reverse direct effects

  • Partial complementation with domain mutants can map critical regions

  • Cross-species complementation can identify conserved vs. species-specific functions

• Multi-omics approach:

  • Integrate transcriptomics, proteomics, and metabolomics data

  • Early changes after AIM31 perturbation suggest direct effects

  • Network analysis can distinguish primary from secondary consequences

  • For example, transcriptomic analysis has been successfully used to compare C. albicans and C. dubliniensis responses in infection models

What are appropriate controls for experiments involving C. dubliniensis AIM31 manipulation?

Robust experimental design requires appropriate controls:

• Genetic manipulation controls:

  • Empty vector control: For overexpression studies, include the same vector without AIM31

  • Marker-only control: For gene deletions, include a strain with the selection marker integrated at a neutral locus

  • Complemented strain: Reintroduction of AIM31 to confirm phenotype is due to its absence

  • Point mutant controls: Non-functional mutant as negative control; conservative mutations as specificity control

• Species-specific considerations:

  • When comparing with C. albicans, use appropriate wild-type strains (e.g., SC5314 for C. albicans, CD36 for C. dubliniensis)

  • For C. dubliniensis genetic studies, two different genetic backgrounds have been validated: MYA-646 (genome sequenced) and a second background used for molecular studies

• Expression controls:

  • Western blotting to confirm protein levels in overexpression/knockdown studies

  • qRT-PCR to verify transcript levels

  • Include parental wild-type strain in all experiments

• Technical controls:

  • Mitochondrial isolation quality: Assess integrity using membrane potential dyes; check for cytosolic contamination

  • Protein purity: Verify recombinant protein purity by SDS-PAGE (>90% purity recommended)

  • Cell viability: Ensure phenotypes aren't due to general growth defects or viability issues

How might AIM31 function be leveraged for developing novel antifungal strategies?

AIM31's role in mitochondrial function presents several avenues for antifungal development:

• Mitochondrial targeting rationale:

  • Mitochondrial function differences between fungi and humans offer selective targeting opportunities

  • C. dubliniensis shows species-specific patterns of antifungal resistance development, including itraconazole resistance without fluconazole cross-resistance

  • AIM31's involvement in respiratory chain function makes it a potential indirect target

• Potential approaches:

  • Combination therapies: Target both AIM31-dependent pathways and conventional antifungal targets

  • Metabolic vulnerabilities: Identify metabolic dependencies created by AIM31 dysfunction

  • Species-specific targeting: Exploit sequence differences between human and fungal mitochondrial proteins

• Research directions:

  • Screen for compounds that disrupt AIM31 interactions with respiratory complexes

  • Investigate metabolic consequences of AIM31 inhibition under different nutrient conditions

  • Explore synergistic effects between mitochondrial inhibitors and conventional antifungals

• Experimental evidence:

  • Studies show C. dubliniensis can develop drug resistance through altered expression of efflux pumps like MDR1

  • The MDR1 gene can be induced by certain drugs in a dose-dependent fashion, suggesting regulatory pathways that might be targeted

  • Mitochondrial function has been linked to azole resistance mechanisms in Candida species

What is the relationship between AIM31 and other mitochondrial inheritance factors in C. dubliniensis?

Understanding the relationship between AIM31 and other mitochondrial factors requires integrated approaches:

• Genetic interaction networks:

  • AIM31 (RCF1) and AIM38 (RCF2) show functional overlap in mitochondrial respiration

  • These proteins may independently bind to the cytochrome bc1-COX supercomplex

  • Systematic genetic interaction studies (e.g., synthetic lethality screens) can identify additional interacting factors

• Comparative genomics insights:

  • AIM proteins were originally identified in screens for genes affecting mitochondrial inheritance

  • C. dubliniensis also possesses AIM36, another mitochondrial protein (B9WAT8) involved in inheritance

  • Sequence comparisons across Candida species can identify conserved motifs and species-specific features

• Integration with cellular pathways:

  • Mitochondrial inheritance connects to cytoskeletal organization, membrane dynamics, and cell cycle regulation

  • AIM31 may function within broader networks controlling organelle distribution

  • Transcript profiling studies comparing C. albicans and C. dubliniensis can reveal co-regulated gene networks

• Technology approaches:

  • Proximity labeling methods (BioID, APEX) to identify the spatial proteome around AIM31

  • Live-cell imaging with tagged mitochondrial components to track inheritance patterns

  • Quantitative trait locus (QTL) analysis to identify natural variation affecting mitochondrial distribution

How does genetic variation in AIM31 contribute to strain differences in C. dubliniensis populations?

Genetic variation in AIM31 may contribute to population-level differences:

• Epidemiological context:

  • C. dubliniensis isolates from HIV-positive patients are more closely related than those from HIV-negative patients

  • Longitudinal genotyping reveals that isolates from the same patient are generally closely related and may undergo microevolution

  • Approximately 8% of clinical isolates exhibited itraconazole resistance in one study

• Methodological approaches:

  • Comparative sequencing: Analysis of AIM31 sequences across clinical isolates

  • Functional studies: Test phenotypic consequences of natural variants

  • Population genetics: Assess selection pressures on AIM31 using dN/dS ratios

• Research findings:

  • C. dubliniensis isolates show genetic microevolution during persistent infection

  • Strain maintenance is common during development of drug resistance, suggesting adaptation rather than replacement

  • Studies using specific DNA probes (e.g., Cd25) can accurately genotype C. dubliniensis isolates

• Future directions:

  • Whole genome sequencing of diverse isolates to place AIM31 variation in genomic context

  • Testing whether specific AIM31 variants correlate with clinical outcomes or resistance patterns

  • Investigating whether mitochondrial function differences contribute to niche adaptation in C. dubliniensis