Recombinant Candida dubliniensis C-5 sterol desaturase (ERG3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Candida dubliniensis C-5 Sterol Desaturase (ERG3)

Recombinant Candida dubliniensis C-5 sterol desaturase (ERG3) is a fungal enzyme critical for ergosterol biosynthesis, a key component of fungal cell membranes. The enzyme catalyzes the introduction of a double bond between C-5 and C-6 in the B ring of sterol precursors, converting episterol to ergosterol. This process is essential for maintaining membrane integrity and fungal viability. Mutations in CdERG3 have been linked to azole antifungal resistance in C. dubliniensis, making it a focal point for studying resistance mechanisms and developing targeted therapies .

Genetic and Sequence Features

  • Cloning and Homology: The CdERG3 gene was cloned using primers designed against the C. albicans ERG3 sequence, amplifying a 530-bp region. Sequence analysis revealed 91.1% homology to C. albicans ERG3 .

  • Mutational Impact: In vitro-generated C. dubliniensis isolates with azole resistance harbor homozygous CdERG3 mutations, altering amino acid sequences and impairing C-5 desaturase activity. These mutations prevent complementation of S. cerevisiae erg3Δ mutants, demonstrating loss of function .

Species-Specific Activity

Recombinant ERG3 enzymes from diverse fungi exhibit varying functional outputs when expressed in C. albicans erg3Δ/Δ mutants:

SpeciesERG3 OrthologErgosterol (%)Key Sterol AccumulationsC-5 Desaturase Activity
C. albicansCaERG379.2 ± 3.3Ergosterol dominantHigh
C. dubliniensisCdERG3~45.0Ergosta-7,22-dienol (34.1 ± 1.4)Moderate
C. glabrataCgERG3~45.0Ergosta-7,22-dienol (58.0 ± 2.4)Low
Rhizopus delemarRdERG3A~17.3Ergosta-7,22-dienol (69.5 ± 3.0)Very Low
Data adapted from comparative sterol profiling studies .

Mechanisms of Azole Resistance

  • C-5 Desaturase Dysfunction: Mutations in CdERG3 reduce ergosterol synthesis, leading to accumulation of toxic intermediates (e.g., episterol) when azole drugs (e.g., itraconazole) inhibit lanosterol 14α-demethylase (S14DM). This mechanism underlies resistance in six of seven C. dubliniensis derivatives .

  • Cross-Resistance Profiles: Unlike other CdERG3-defective strains, derivative CD570-A retained susceptibility to amphotericin B, suggesting alternative resistance pathways (e.g., CdERG11 upregulation) .

Gene Expression and Resistance

  • CdERG11 Upregulation: CD570-A exhibited elevated CdERG11 expression, which may compensate for impaired ergosterol biosynthesis. No mutations in CdERG11 were identified, indicating transcriptional regulation as a resistance mechanism .

  • Stress Adaptation: Low ERG3 expression in C. albicans reduces stress tolerance and hyphal growth but does not fully abolish pathogenicity, suggesting partial redundancy in sterol biosynthesis .

Sterol Composition in ERG3-Deficient Strains

Below is a comparison of sterol profiles in C. albicans erg3Δ/Δ mutants expressing different ERG3 homologs:

SterolWild-Type (%)erg3Δ/Δ (%)CdERG3 (%)CgERG3 (%)RdERG3A (%)
Ergosterol79.2 ± 3.317.3 ± 0.945.045.017.3
Ergosta-7,22-dienol4.3 ± 0.469.5 ± 3.034.1 ± 1.458.0 ± 2.469.5 ± 3.0
Episterol (Ergosta-7,24(28)-dienol)13.3 ± 1.913.3 ± 1.913.2 ± 0.76.7 ± 5.013.3 ± 1.9
Data adapted from GC-MS/MS analysis of sterol content .

Targeting Ergosterol Biosynthesis

  • Drug Development: Understanding CdERG3’s role in resistance highlights the ergosterol pathway as a therapeutic target. Inhibitors of C-5 desaturase or upstream enzymes (e.g., S14DM) may counteract resistance mechanisms .

  • Species-Specific Resistance: Cross-species differences in ERG3 activity (e.g., C. glabrata vs. C. dubliniensis) suggest that antifungal efficacy may vary depending on the fungal pathogen, necessitating tailored therapies .

Pathogenicity and Virulence

  • Host Interaction: ERG3 inactivation in C. albicans reduces gut colonization and systemic dissemination in mice, linking ergosterol biosynthesis to virulence. Similar studies in C. dubliniensis could elucidate its pathogenic strategies .

  • Diagnostic Tools: Recombinant CdERG3 may serve as a biomarker for detecting C. dubliniensis infections or monitoring resistance evolution .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ERG3; CD36_04520; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Target Names
ERG3
Target Protein Sequence
MDIVLEICDYYLFDKVYADVFPKDGPVHEYLKPAIQSFSEINFPKLQNWDSFDTNSTLIS SNNFNISNVNPATIPGYLLSKIASYQDKSEIYGLAPKFFPATEFIDTSFLSRSNIFREVL SLFIITTLFGWLLYFIVAYLSYVFVFDKKIFNHPRYLKNQMSLEIKRATSAIPVMVLLTI PFFLLELHGYSFLYEEINESTGGYKAILWQIPKFILFTDCGIYFLHRWLHWPSVYKALHK PHHKWIVCTPFASHAFHPVDGFFQSLPYHLYPLLFPLHKVLYLLLFTFVNFWTVMIHDGS YWSNDPVVNGTACHTVHHLYFNYNYGQFTTLWDRLGNSYRRPDDSLFVKDQKKEEEKKIW KEQTRQMEEIRGEVEGKVDDREYIDQ
Uniprot No.

Target Background

Function
Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. This enzyme may play a role in regulating ergosterol biosynthesis.
Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of C-5 sterol desaturase (ERG3) in Candida dubliniensis?

C-5 sterol desaturase (Erg3p) in Candida dubliniensis plays a fundamental role in ergosterol biosynthesis by catalyzing the introduction of a C-5,6 double bond in the sterol precursor. Specifically, Erg3p functions as sterol Δ5,6-desaturase in the ergosterol biosynthesis pathway. This enzyme is particularly significant in the context of azole antifungals, as it is responsible for converting lanosterol/14α-methylfecosterol (which accumulates when Erg11p is inhibited by azoles) into toxic diol species that inhibit fungal growth . The absence or reduced function of Erg3p prevents the formation of these toxic diols, potentially allowing continued growth in the presence of azoles .

How does ERG3 expression change during azole exposure in Candida species?

Research indicates that ERG3 expression responds dynamically to azole exposure, though patterns may differ between Candida species. In C. dubliniensis, studies using RT-PCR and real-time PCR have demonstrated that biofilm formation coupled with fluconazole exposure leads to upregulation of the ERG3 gene . This upregulation appears to be a part of the adaptive response to azole stress. The expression pattern differs from other ergosterol biosynthesis genes such as ERG11, which shows low to moderate expression regulated more by fluconazole addition than by biofilm formation . In contrast, ERG1, ERG7, and ERG25 often show very low or non-detectable expression in C. albicans under similar conditions .

How does the titration of C-5 sterol desaturase activity affect azole resistance and virulence?

Recent research has revealed a nuanced relationship between Erg3p activity levels, azole resistance, and pathogenicity. Studies using an isogenic panel of strains expressing various levels of ERG3 transcript have demonstrated that even moderate reductions in Erg3p activity can significantly enhance growth in the presence of fluconazole without compromising fitness . Analysis of sterol composition confirmed a correspondingly wide range of Erg3p activity across these strains.

Importantly, low levels of Erg3p activity (rather than complete absence) appear to provide an optimal balance between azole resistance and virulence. Even strains with minimal Erg3p activity can maintain full virulence in mouse models of disseminated infection, whereas complete null mutants often show reduced virulence . The relationship between Erg3p activity and fluconazole efficacy is particularly evident in immunocompromised hosts, where an inverse correlation exists between Erg3p activity and the capacity of C. albicans to survive treatment .

This titration effect suggests that partial Erg3p inhibition may provide an evolutionary advantage over complete loss of function in clinical settings, potentially explaining why partial function mutants might be selected during azole therapy rather than null mutants.

What distinguishes ERG3 mutant phenotypes from other azole resistance mechanisms?

The phenotypic characteristics of ERG3-deficient mutants are qualitatively and quantitatively distinct from other azole resistance mechanisms and from trailing growth. Unlike resistance mediated by drug efflux pumps or target enzyme modifications, ERG3-mediated resistance is partly dependent on environmental conditions such as temperature and pH .

Distinctive features of ERG3 mutants include:

  • Temperature and pH sensitivity: The growth capacity of erg3Δ/Δ mutants in the presence of azoles is partly influenced by temperature and pH, similar to trailing isolates but unlike efflux-mediated resistance .

  • Membrane damage: Both erg3Δ/Δ mutants and trailing isolates sustain significant membrane damage upon azole treatment, distinguishing them from resistant isolates with other mechanisms .

  • Calcineurin independence: Unlike trailing isolates, the azole insensitivity of erg3Δ/Δ mutants is unaffected by calcineurin inhibitors like cyclosporin A, providing a key differential characteristic .

  • Complete azole insensitivity: ERG3 inactivation can result in complete azole insensitivity in a single step, unlike the incremental resistance often seen with efflux pump overexpression .

These distinctions have important implications for laboratory identification and clinical management of resistant isolates.

What molecular mechanisms lead to ERG3 dysfunction in clinical isolates?

The molecular basis for ERG3 dysfunction in clinical isolates primarily involves mutations within the CdERG3 gene that impair enzyme function. In C. dubliniensis, research has identified various mutations in ERG3 alleles that result in loss of function . These mutations prevent the proper functioning of the C-5 sterol desaturase enzyme, as confirmed by complementation studies in Saccharomyces cerevisiae erg3 mutants, where the mutated alleles failed to restore function .

The molecular mechanisms can include:

  • Point mutations leading to amino acid substitutions in crucial functional domains

  • Frameshift mutations resulting in truncated, non-functional proteins

  • Regulatory mutations affecting ERG3 expression levels

Analysis of itraconazole-resistant C. dubliniensis derivatives revealed that loss of function of CdErg3p was the primary mechanism of resistance in six out of seven studied derivatives . These findings suggest that ERG3 mutations are a significant pathway to azole resistance in laboratory settings, though they may be less common in clinical isolates due to fitness costs.

What are the most effective methods for generating and validating recombinant C. dubliniensis ERG3?

Generating and validating recombinant C. dubliniensis ERG3 requires a systematic approach:

Expression System Selection:

  • S. cerevisiae expression systems using galactose-inducible promoters have proven effective for functional studies of Candida ERG3

  • E. coli systems may be used for protein production but often require refolding due to inclusion body formation

Cloning Strategy:

  • PCR amplification of the CdERG3 open reading frame from C. dubliniensis genomic DNA

  • Incorporation into appropriate expression vectors with selection markers (typically URA3 for yeast systems)

  • Transformation into host cells using lithium acetate or electroporation methods

Validation Approaches:

  • Complementation assays using S. cerevisiae erg3 mutants grown on synthetic complete medium lacking uracil (SC-URA) containing 2% galactose

  • Sterol profile analysis using gas chromatography-mass spectrometry (GC-MS)

  • Western blotting with ERG3-specific antibodies

  • Enzyme activity assays measuring the conversion of ergosta-7,24(28)-dien-3β-ol to ergosta-5,7,24(28)-trien-3β-ol

Expression Confirmation:

  • RT-PCR and real-time PCR to quantify transcript levels

  • Protein purification and SDS-PAGE analysis

  • Mass spectrometry identification

The complementation assay is particularly valuable as it demonstrates functional activity rather than mere presence of the protein, confirming that the recombinant ERG3 can restore normal sterol biosynthesis in an erg3-deficient background.

How can researchers effectively measure C-5 sterol desaturase activity in experimental systems?

Measuring C-5 sterol desaturase activity requires specialized techniques that assess enzyme function both directly and indirectly:

Direct Enzymatic Assays:

  • Microsomal preparation from recombinant cells expressing ERG3

  • Incubation with labeled substrate (ergosta-7,24(28)-dien-3β-ol)

  • Extraction and analysis of sterol products using HPLC or GC-MS

  • Quantification of substrate-to-product conversion rates

Indirect Assessment Through Sterol Profiling:

  • Total sterol extraction from cells using alkaline hydrolysis followed by organic extraction

  • GC-MS analysis to identify and quantify sterol intermediates

  • Calculation of ratios between substrate and product sterols

  • Comparison with wild-type and known mutant profiles

Gene Expression Analysis:

  • Quantitative RT-PCR to measure ERG3 transcript levels under different conditions

  • Correlation of expression with phenotypic azole resistance

Phenotypic Assays:

  • Growth inhibition assays in the presence of azoles using CLSI broth microdilution method

  • Assessment of temperature and pH dependency of growth in azole presence

  • Membrane integrity assessments using fluorescent dyes or reporter systems

A comprehensive approach combining these methods provides the most reliable assessment of ERG3 activity, especially when validating recombinant constructs or characterizing clinical isolates.

What experimental designs best elucidate the relationship between ERG3 activity and azole resistance?

To effectively investigate the relationship between ERG3 activity and azole resistance, researchers should consider these experimental approaches:

Gene Expression Modulation:

  • Construction of isogenic strain panels with variable ERG3 expression levels using controllable promoters

  • Creation of site-directed mutants with specific alterations to functional domains

  • Heterologous expression systems to isolate ERG3 effects from other resistance mechanisms

In Vitro Susceptibility Testing:

  • Standard CLSI broth microdilution assays at multiple time points (24h and 48h)

  • Modified conditions testing (various pH levels, temperatures, media compositions)

  • Time-kill assays to distinguish fungistatic from fungicidal effects

  • Testing with calcineurin inhibitors to differentiate from trailing growth

Membrane Function Assessment:

  • Membrane permeability assays using reporter systems (e.g., Nluc release)

  • Rhodamine 6G efflux measurements to assess membrane properties

  • Lipidomic analysis to characterize membrane composition alterations

In Vivo Models:

  • Mouse models of disseminated candidiasis with both immunocompetent and leukopenic animals

  • Vaginal candidiasis models which show different outcomes from systemic models

  • Tissue burden quantification and histological examination

The most informative experimental design would incorporate a strain series with graduated levels of ERG3 activity, testing both in vitro and in vivo to capture the complex relationship between enzyme activity, azole resistance, and virulence in different host environments .

How can researchers distinguish between true azole resistance and trailing growth when studying ERG3 mutants?

Distinguishing between true azole resistance and trailing growth in ERG3 mutants requires careful experimental design and analysis:

Key Differential Characteristics:

FeatureTrue Resistance (e.g., efflux)ERG3 Mutant PhenotypeTrailing Growth
Temperature & pH dependencyIndependentPartly dependentHighly dependent
Calcineurin inhibitor effectNoneNoneEliminates growth
Membrane damage upon azole exposureMinimalSignificantSignificant
Growth at 48h vs. 24hResistant at both timepointsFully resistantSusceptible at 24h, resistant at 48h
In vivo efficacy of azolesPoorVariable by modelGenerally good

Analytical Approaches:

  • Conduct susceptibility testing under multiple conditions (37°C vs. 30°C, pH 7.0 vs. pH 3.0)

  • Include calcineurin inhibitors (cyclosporin A) in parallel assays

  • Assess membrane integrity using appropriate assays

  • Measure both 24h and 48h endpoints in susceptibility testing

  • Correlate in vitro findings with in vivo outcomes in different animal models

True ERG3-mediated resistance is distinguished by insensitivity to azoles that persists regardless of calcineurin inhibition but may be affected by environmental conditions. Complete molecular characterization including sequencing of the ERG3 gene and measurement of sterol profiles provides definitive evidence .

What are the challenges in correlating in vitro ERG3 activity with in vivo azole efficacy?

Researchers face several significant challenges when attempting to correlate in vitro ERG3 activity with in vivo azole efficacy:

Host Immune Status Influence:
Studies have revealed striking differences in azole efficacy against ERG3 mutants depending on host immune status. While antifungal efficacy may be similar in immunocompetent mice regardless of ERG3 activity levels, there is an inverse correlation between ERG3 activity and C. albicans survival during treatment in leukopenic mice . This demonstrates that host immunity plays a critical role in determining the clinical impact of this resistance mechanism.

Tissue-Specific Differences:
ERG3 mutants show context-dependent virulence and azole susceptibility. For example, an erg3Δ/Δ deletion mutant shown to have severely reduced virulence in a disseminated infection model was still resistant to fluconazole treatment in terms of tissue burden. The same mutant readily colonized and induced pathology in a vaginal candidiasis model and displayed resistance to fluconazole treatment . These tissue-specific differences complicate the translation of in vitro findings to clinical scenarios.

Fitness Cost Considerations:
The fitness costs of ERG3 mutations may manifest differently in laboratory versus host environments. While complete loss of ERG3 function confers robust azole resistance in vitro, the associated membrane abnormalities, hypersensitivity to physiological stresses, defective hyphal growth, and reduced virulence may impose counter-selective pressure in patients . This discrepancy explains why ERG3 mutations are less frequently observed in clinical isolates than other resistance mechanisms.

Partial Activity Effects:
Recent research suggests that partial rather than complete loss of ERG3 activity may offer an optimal balance between azole resistance and maintained fitness/virulence . This nuanced relationship is difficult to capture in standard in vitro testing, which typically categorizes isolates as simply "resistant" or "susceptible."

To address these challenges, researchers should employ comprehensive approaches that include:

  • Testing in both immunocompetent and immunocompromised animal models

  • Evaluating multiple infection sites

  • Creating graduated levels of ERG3 activity rather than simple presence/absence comparisons

  • Assessing long-term persistence and adaptation during azole therapy

How should researchers interpret contradictory findings regarding ERG3 mutations in clinical versus laboratory settings?

The apparent contradiction between the frequent selection of erg3 mutants in laboratory settings and their relative scarcity among clinical isolates requires careful interpretation:

Potential Explanations for the Discrepancy:

  • Fitness Trade-offs: ERG3 inactivation produces membrane abnormalities and stress sensitivities that may be tolerable in laboratory media but severely disadvantageous in the complex host environment . Complete null mutants show reduced virulence in many infection models, suggesting they may be eliminated from infected patients despite their azole resistance.

  • Partial Activity Advantage: Recent research indicates that partial rather than complete reductions in ERG3 activity may confer significant azole resistance while maintaining virulence . Laboratory selection often identifies complete null mutants, which may not represent the more clinically relevant partial-activity variants.

  • Host Immunity Effects: The differential impact of azole treatment on erg3 mutants in immunocompetent versus immunocompromised hosts suggests that immunity plays a crucial role in determining the clinical significance of this mechanism . Laboratory studies may not adequately model these immune interactions.

  • Niche-Specific Selection: The observation that erg3 mutants can effectively colonize and resist azole treatment in vaginal candidiasis models but show reduced virulence in disseminated infection suggests site-specific selection pressures . The anatomical site of infection may determine whether ERG3 mutations provide an advantage or disadvantage.

  • Detection Limitations: Clinical studies may underreport ERG3 mutations due to methodological limitations, including focus on more common resistance mechanisms or difficulty in phenotypic identification of partial function mutants.

Interpretive Framework:
Researchers should interpret these contradictions by considering that ERG3 mutations likely represent a context-dependent resistance mechanism. Their clinical relevance may be restricted to specific patient populations (particularly immunocompromised hosts), infection sites (potentially mucosal rather than systemic), or therapeutic scenarios (long-term azole prophylaxis). Additionally, the binary view of ERG3 function should be replaced with a continuum model where partial activity mutants may have greater clinical significance than complete null mutants.

How do C. dubliniensis ERG3 mutations compare to those in C. albicans regarding azole resistance mechanisms?

A comparative analysis of ERG3 mutations in C. dubliniensis and C. albicans reveals both similarities and species-specific differences:

Similarities:

  • In both species, loss of ERG3 function results in azole resistance by preventing the formation of toxic sterol diols following azole treatment .

  • Both species show altered membrane sterol compositions in ERG3 mutants, with accumulation of 14α-methylfecosterol instead of toxic 14α-methylergosta-8,24(28)-dien-3β,6α-diol .

  • In laboratory settings, ERG3 mutations can be readily selected in both species following azole exposure .

Differences:

  • Studies with C. dubliniensis have specifically identified ERG3 dysfunction as the primary mechanism of in vitro-generated itraconazole resistance in the majority of derivatives (six out of seven studied) , suggesting it may be a more common adaptation pathway in this species.

  • C. dubliniensis shows distinct patterns of ERG gene expression during biofilm formation and azole exposure compared to C. albicans, particularly regarding the upregulation of ERG3 and ERG25 genes following fluconazole exposure in biofilms .

  • The rhodamine 6G efflux, which indirectly measures membrane properties, is decreased in itraconazole-resistant C. dubliniensis derivatives compared to parental isolates , indicating potentially different membrane adaptation mechanisms.

Molecular Analysis:
Molecular characterization of ERG3 mutations in C. dubliniensis has confirmed their causative role in azole resistance through complementation studies in S. cerevisiae erg3 mutants . Similar molecular confirmation approaches have been applied to C. albicans, though the specific mutation patterns may differ between species.

The comparative study of these closely related but distinct Candida species provides valuable insights into both conserved and divergent pathways of adaptation to azole stress, potentially informing species-specific therapeutic approaches.

How can researchers leverage comparative genomics to identify conserved functional domains in ERG3 across Candida species?

Researchers can employ several comparative genomics approaches to identify conserved functional domains in ERG3 across Candida species:

Multiple Sequence Alignment (MSA) Analysis:

  • Collect ERG3 coding sequences from multiple Candida species (C. albicans, C. dubliniensis, C. glabrata, C. parapsilosis, etc.)

  • Perform MSA using tools like MUSCLE, CLUSTALW, or T-Coffee

  • Identify regions of high sequence conservation, which often correspond to functional domains

  • Calculate conservation scores across alignment positions to quantify domain preservation

Structural Prediction and Comparison:

  • Generate homology-based structural models of ERG3 proteins from different species using tools like I-TASSER or SWISS-MODEL

  • Compare predicted structures to identify conserved folding patterns and catalytic sites

  • Map known mutations that affect function onto structural models to identify critical domains

  • Assess conservation of transmembrane domains, which are essential for proper localization and function

Functional Domain Identification:

  • Use protein family databases (Pfam, InterPro) to identify recognized functional domains

  • Compare these annotated domains across species to assess conservation

  • Analyze known ERG3 mutations from azole-resistant isolates to determine which domains are most frequently affected

  • Perform in silico docking studies with sterol substrates to identify potential binding sites

Evolutionary Analysis:

  • Construct phylogenetic trees of ERG3 sequences across Candida and related species

  • Calculate selection pressures (dN/dS ratios) across different regions of the protein

  • Identify regions under purifying selection (highly conserved) versus diversifying selection

  • Correlate evolutionary conservation with functional importance

Experimental Validation:

  • Design chimeric proteins with domains swapped between species to test functional conservation

  • Create site-directed mutations in highly conserved residues across multiple species

  • Express recombinant proteins in S. cerevisiae erg3 mutants to test complementation

  • Measure enzymatic activity of purified proteins from different species

This comprehensive approach allows researchers to identify not only the conserved domains essential for core ERG3 function but also potentially variable regions that might contribute to species-specific differences in azole susceptibility, stress responses, or virulence characteristics.

What novel approaches could target ERG3 activity to overcome azole resistance in Candida infections?

Several innovative strategies could be developed to target ERG3 activity and overcome azole resistance:

Dual-Target Antifungal Approaches:

  • Development of compounds that simultaneously inhibit both ERG11 (the target of azoles) and alternative sterol biosynthesis pathways that become essential in ERG3 mutants

  • Creation of drug combinations that target both membrane integrity (compromised in ERG3 mutants) and ergosterol biosynthesis

  • Design of molecules that restore toxic sterol accumulation in ERG3-deficient cells through alternative metabolic routes

ERG3 Activity Modulators:

  • Development of compounds that enhance residual ERG3 activity in partial function mutants

  • Creation of small molecules that stabilize ERG3 protein structure to prevent mutation-induced dysfunction

  • Design of drugs that exploit the membrane vulnerabilities created by ERG3 mutations

Targeting ERG3-Related Cellular Adaptations:

  • Identification of compensatory pathways activated in ERG3 mutants that could serve as novel drug targets

  • Development of inhibitors for enzymes that process alternative sterols produced in ERG3-deficient cells

  • Design of compounds that prevent adaptation to membrane stress resulting from altered sterol composition

Host-Directed Therapies:
Given the critical role of host immunity in determining the clinical impact of ERG3 mutations , development of immunomodulatory approaches that specifically enhance host responses against ERG3 mutants could prove effective.

Genetic Approaches:
Development of CRISPR-based or antisense technologies that could restore ERG3 function in resistant isolates or selectively target cells with ERG3 mutations.

These approaches offer promising avenues for overcoming azole resistance mediated by ERG3 dysfunction, particularly in challenging clinical scenarios involving immunocompromised patients.

How might understanding ERG3 activity levels inform personalized antifungal therapy approaches?

Understanding the relationship between ERG3 activity levels and azole efficacy could significantly advance personalized antifungal therapy in several ways:

Resistance Mechanism Stratification:
Recent research demonstrating that partial rather than complete loss of ERG3 activity may offer an optimal balance between azole resistance and maintained virulence suggests that quantitative assessment of ERG3 function could provide more clinically relevant information than binary resistant/susceptible classifications. Patients with infections caused by isolates with different levels of ERG3 activity might benefit from tailored treatment approaches.

Patient-Specific Factors:
The finding that host immune status critically determines the clinical impact of ERG3-mediated resistance indicates that personalized therapy should consider both pathogen characteristics and host factors. For immunocompromised patients, even low-level ERG3 dysfunction might predict poor response to azole therapy, warranting alternative approaches.

Monitoring and Adaptation:
Serial monitoring of ERG3 activity in isolates during prolonged antifungal therapy could detect emergent resistance before clinical failure. Changes in ERG3 function could trigger proactive therapy adjustments based on predicted efficacy.

Precision Medicine Framework:
A comprehensive approach to personalized antifungal therapy informed by ERG3 activity might include:

  • Diagnostic Testing: Development of rapid assays to assess ERG3 functionality in clinical isolates

  • Resistance Profiling: Comprehensive characterization of resistance mechanisms including ERG3 activity levels

  • Host Immunity Assessment: Evaluation of immune function relevant to Candida clearance

  • Treatment Algorithm: Integration of pathogen and host factors to select optimal therapy

    ERG3 StatusImmune StatusRecommended Approach
    Normal activityAnyStandard azole therapy
    Partial activityImmunocompetentHigher-dose azole therapy
    Partial activityImmunocompromisedAlternative antifungal class
    No activityAnyNon-azole antifungal
  • Monitoring Strategy: Schedule for follow-up testing based on resistance risk

This personalized approach would move beyond current susceptibility testing paradigms to incorporate the nuanced relationship between ERG3 activity, azole efficacy, and host immunity, potentially improving outcomes for patients with invasive Candida infections.

What are the potential ecological implications of ERG3 mutations in environmental and commensal Candida populations?

The ecological implications of ERG3 mutations in environmental and commensal Candida populations present a complex area for future research:

Antifungal Selection Pressure:
The increasing use of azole antifungals in both clinical settings and agriculture may create selection pressure favoring ERG3 mutations in diverse environments:

  • Clinical Environments: Long-term azole prophylaxis in immunocompromised patients could select for ERG3 mutants with optimized fitness-resistance balance.

  • Agricultural Settings: Agricultural azole fungicides might select for ERG3 mutations in environmental Candida populations.

  • Commensal Microbiomes: Repeated azole exposure for recurrent vaginal candidiasis or oral thrush could shift commensal populations toward ERG3 variants.

Transmission and Population Dynamics:
The persistence and transmission patterns of ERG3 mutants may differ from wild-type strains:

  • Niche-Specific Adaptation: ERG3 mutants may establish in specific anatomical niches where their altered phenotype provides advantages or where azole concentrations create selective pressure.

  • Host-to-Host Transmission: Altered virulence characteristics might impact transmission efficiency between hosts.

  • Environmental Reservoirs: Reduced fitness in natural environments might limit the establishment of environmental reservoirs for ERG3 mutant strains.

Microbial Community Interactions:
Altered sterol composition in ERG3 mutants likely affects interactions with other microorganisms:

  • Competitive Dynamics: Changed membrane properties could alter competitive dynamics with other microbes in polymicrobial communities.

  • Biofilm Formation: ERG3 mutations may impact the ability to form mixed-species biofilms, particularly given the distinct ERG3 expression patterns observed during biofilm formation .

  • Host Immune Interactions: Modified surface characteristics could alter recognition by the host immune system, potentially changing the ecological balance in the host microbiome.

Understanding these ecological implications will require integrated studies across clinical, agricultural, and environmental settings, with particular attention to the maintenance and spread of partial-function ERG3 variants that may represent the most ecologically successful form of this resistance mechanism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.