Recombinant Candida dubliniensis Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Description

Role in Crista Junction Formation

The primary function of FCJ1 is in the formation and maintenance of crista junctions, which are critical structural elements in mitochondria . Crista junctions are narrow tubular openings that connect the inner boundary membrane with the cristae membranes, thereby compartmentalizing the mitochondrial inner membrane into functionally distinct domains . Research on FCJ1 orthologs in other species has revealed that this protein localizes specifically to these crista junction sites .

Studies have demonstrated that cells lacking FCJ1 exhibit dramatic alterations in mitochondrial ultrastructure, with a complete absence of crista junctions . Instead, these cells develop concentric stacks of inner membrane within the mitochondrial matrix, significantly disrupting normal mitochondrial morphology and potentially impacting function . This observation underscores the essential role of FCJ1 in maintaining proper mitochondrial membrane architecture.

Interaction with ATP Synthase Complexes

An intriguing aspect of FCJ1 function is its relationship with F1F0-ATP synthase (F1F0) complexes in the mitochondrial inner membrane . Research has revealed an inverse relationship between FCJ1 levels and the formation of F1F0 supercomplexes . Specifically, cells lacking FCJ1 show increased levels of F1F0 supercomplexes, while overexpression of FCJ1 leads to reduced levels of these supercomplexes .

This relationship suggests that FCJ1 may play a regulatory role in the spatial organization of F1F0 complexes within the mitochondrial membrane, potentially influencing energy production capacity . The antagonistic relationship between FCJ1 and F1F0 supercomplex formation provides insight into the molecular mechanisms underlying cristae formation and maintenance.

Effects of FCJ1 Overexpression

Experimental overexpression of FCJ1 results in a range of alterations to mitochondrial membrane structure, including:

  1. Increased crista junction formation

  2. Branching of cristae membranes

  3. Enlargement of crista junction diameter

These observations further support the critical role of FCJ1 in determining mitochondrial inner membrane topology . The ability of FCJ1 to induce changes in membrane curvature and organization suggests that it may interact with phospholipids in the inner membrane and/or with other proteins involved in membrane remodeling.

dubliniensis as an Emerging Pathogen

Understanding the function of FCJ1 in C. dubliniensis requires context regarding the organism itself. C. dubliniensis is an opportunistic yeast pathogen closely related to C. albicans, the most common cause of candidiasis in humans . Initially identified primarily in oral cavities of HIV-infected individuals and AIDS patients, C. dubliniensis has since been isolated from various clinical specimens, including blood, respiratory samples, and urinary tract .

Studies have shown that C. dubliniensis accounts for a small but significant proportion of Candida bloodstream infections, with increasing prevalence noted in recent years . Between 2008-2010, C. dubliniensis represented approximately 2% of Candida bloodstream isolates in one comprehensive study, compared to 0.4-0.6% in earlier periods . This trend suggests a potentially expanding role for this organism in clinical infections.

Potential Role of FCJ1 in C. dubliniensis Pathogenicity

While direct evidence linking FCJ1 to C. dubliniensis virulence is limited, the protein's essential role in mitochondrial function suggests it may contribute to the organism's adaptive capabilities . Mitochondrial function is critical for cellular energy production, stress response, and adaptation to different host environments—all factors that can influence pathogenicity.

In other fungal pathogens, mitochondrial function has been linked to virulence traits such as morphological switching, biofilm formation, and stress resistance. Given that C. dubliniensis can persist in diverse host niches, from the oral cavity to the bloodstream, properly functioning mitochondria likely support this adaptability .

Applications in Basic and Applied Research

The recombinant C. dubliniensis FCJ1 protein serves as a valuable tool for various research applications:

  1. Structural studies to elucidate the molecular architecture of crista junctions

  2. Investigation of protein-protein interactions within the MICOS complex

  3. Development of diagnostic tools for C. dubliniensis identification

  4. Exploration of potential drug targets affecting mitochondrial function in fungal pathogens

  5. Comparative studies between C. dubliniensis and C. albicans biology

The availability of high-purity recombinant protein facilitates these applications by providing a standardized reagent for experimental use .

Gene Identity and Organization

The FCJ1 protein in C. dubliniensis is encoded by the MIC60 gene (alternative designation: CD36_28660) . This gene belongs to the broader family of genes encoding MICOS complex components found across eukaryotic organisms, highlighting the evolutionary conservation of mitochondrial architecture mechanisms .

The gene product is identified in protein databases under the UniProt ID B9WLF1, facilitating cross-reference with other molecular databases and research platforms . This standardized identification enables comparative genomic and proteomic analyses across fungal species.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MIC60; CD36_28660; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-564
Protein Length
Full Length of Mature Protein
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Target Names
MIC60
Target Protein Sequence
VSTSTVRFNNAPKVVSPPVPPTVKPQGSEIPPPPPPPPKTKKFSLFGFLFKTTLLATVVY GGTLYAATKNDKVMDFVIDKQLPFHEELIDFIENGSTEDLEEAWENLKSKFTNVKLPTKD DIDELTQKLEHRGEDIIKETKKKIASTHIGHKSGTDLTPAEQLQRGVEIESVKKDFAHLP LIELNSDLGKSVDDTVKQTITSFNNFIQSIDASSLANKDDKLVASVNTSVNQLASRLNSL TKDFDNELQKKLKVSQTELFSSFTRKELELTENLLHQFSTEKQQLESKLNQKLNQEIQAA RAAISQAASNAVAMVRIEQTKNFEKLVSEKLNEERTGRLANLEKLNDRIIELEKFAEGFE TQIVSNHKKAIIHQTVSKLKSLLLAPTAGDKPQPIKPYLDELTKIASDDEVLKLAIKDLS PLVTNESTHSILTNAQLLSRWEQLAPELRSASLLPPNAGLLGHLASIVFSKLLLPVKGIK EDGKDIESVIGRVESSLARGELDIAVEEAANLKGWSRKLANDWVVEGRKRLEIEFLLGLI ESESRII
Uniprot No.

Target Background

Function
Formation of crista junctions protein 1 (FCJ1) is a component of the MICOS complex, a large protein complex residing within the mitochondrial inner membrane. It plays crucial roles in maintaining crista junctions, preserving the inner membrane architecture, and facilitating the formation of contact sites with the outer membrane. FCJ1 plays a critical role in connecting cristae membranes to the inner boundary membrane. It also contributes to protein import via the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Candida dubliniensis and why is it significant in research?

Candida dubliniensis is a recently described yeast species that was first isolated from AIDS patients in Dublin, Ireland. It is closely related to C. albicans but represents a distinct species with unique phenotypic and genotypic characteristics. The significance of C. dubliniensis lies in its emergence as an opportunistic pathogen, particularly in HIV-infected individuals and AIDS patients, with the potential to cause invasive disease including bloodstream infections .

The organism has been recovered from patients in widespread geographic locations, with incidence data showing it can be isolated from 27% of HIV-infected individuals and 32% of AIDS patients with clinical symptoms of oral candidiasis . Its clinical importance is further highlighted by its ability to develop resistance to fluconazole, a commonly used antifungal drug, particularly in HIV-positive patients .

Research on C. dubliniensis proteins, including FCJ1, is valuable for understanding pathogen biology, developing diagnostic tools, and potentially identifying novel therapeutic targets.

What is the FCJ1 protein and what is its biological function?

Formation of crista junctions protein 1 (FCJ1), also known as MIC60 or Mitofilin, is a mitochondrial protein that forms part of the MICOS complex (Mitochondrial Contact Site and Cristae Organizing System) . The protein plays a critical role in:

  • Maintaining mitochondrial inner membrane architecture

  • Formation and stabilization of crista junctions

  • Organizing contact sites between the inner and outer mitochondrial membranes

  • Supporting mitochondrial protein import and respiratory chain assembly

In C. dubliniensis, the mature FCJ1 protein spans amino acids 18-564, containing regions essential for membrane association and protein-protein interactions . Its function is inferred from homologous proteins in other fungi, particularly Saccharomyces cerevisiae, where FCJ1/Mic60 disruption leads to abnormal cristae morphology and compromised mitochondrial function.

How does recombinant C. dubliniensis FCJ1 differ from the native protein?

The recombinant C. dubliniensis FCJ1 protein differs from the native form in several important aspects:

CharacteristicNative FCJ1Recombinant FCJ1
SourceC. dubliniensis mitochondriaE. coli expression system
StructureIntegrated in mitochondrial membraneSolubilized protein
ModificationsNative post-translational modificationsLacks fungal-specific modifications
TagsNoneN-terminal His-tag
FoldingNative conformationMay have altered tertiary structure
SequenceFull sequence (including signal peptide)Mature protein sequence (aa 18-564)

These differences must be considered when designing experiments and interpreting results, as they may affect protein activity, binding properties, and structural studies.

What are the optimal conditions for handling recombinant C. dubliniensis FCJ1 protein?

For optimal handling of recombinant C. dubliniensis FCJ1 protein, researchers should follow these evidence-based guidelines:

  • Storage:

    • Store lyophilized protein at -20°C to -80°C upon receipt

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage

  • Buffer conditions:

    • Standard storage in Tris/PBS-based buffer, pH 8.0, containing 6% trehalose

    • For functional assays, verify compatibility with specific buffer requirements

  • Stability considerations:

    • Avoid repeated freeze-thaw cycles as they may cause protein denaturation

    • Monitor protein integrity through SDS-PAGE or size exclusion chromatography

Following these guidelines will help maintain protein integrity and functionality for experimental applications.

How can researchers verify the identity and purity of recombinant C. dubliniensis FCJ1?

Verification of recombinant C. dubliniensis FCJ1 identity and purity requires multiple complementary approaches:

  • SDS-PAGE analysis:

    • Expected molecular weight: ~60-65 kDa (including His-tag)

    • Purity should exceed 90% as determined by densitometry

  • Western blotting:

    • Primary detection: anti-His antibodies to detect the N-terminal tag

    • Secondary verification: FCJ1/MIC60-specific antibodies (if available)

  • Mass spectrometry:

    • Peptide mass fingerprinting for sequence verification

    • Coverage should include unique peptides distinguishing FCJ1 from homologous proteins

  • Functional assays:

    • Membrane binding capacity

    • Protein-protein interaction studies with other MICOS components

  • N-terminal sequencing:

    • Confirmation of correct processing (starting at amino acid 18)

    • Verification of His-tag presence

A comprehensive verification protocol should include at least three of these methods to ensure confidence in protein identity and purity.

What experimental systems are suitable for studying C. dubliniensis FCJ1 function?

Several experimental systems can effectively study C. dubliniensis FCJ1 function, each with specific advantages:

  • In vitro reconstitution systems:

    • Liposome incorporation to study membrane interactions

    • Reconstitution with other MICOS components to assess complex formation

    • Advantages: Controlled environment, direct measurement of biochemical properties

  • Heterologous expression in model fungi:

    • FCJ1/MIC60 knockout strains of S. cerevisiae complemented with C. dubliniensis FCJ1

    • Advantages: Assessment of in vivo function, mitochondrial phenotype rescue

  • C. dubliniensis genetic modification:

    • CRISPR/Cas9-mediated gene editing to create FCJ1 mutants

    • Conditional expression systems to study FCJ1 depletion effects

    • Advantages: Native context, relevance to pathogen biology

  • Mammalian cell culture models:

    • Expression in mammalian cells to study interspecies compatibility

    • Localization studies and effects on host mitochondria

    • Advantages: Relevance to host-pathogen interactions

  • Biophysical approaches:

    • Structural studies (X-ray crystallography, cryo-EM)

    • Dynamic studies using FRET or other fluorescence techniques

    • Advantages: Detailed molecular information on protein structure and interactions

Selection of the appropriate system depends on the specific research question, available resources, and technical expertise.

How does C. dubliniensis FCJ1 compare to homologous proteins in C. albicans and other fungi?

The C. dubliniensis FCJ1 protein shares significant sequence and functional homology with related proteins in other fungi, particularly C. albicans, but with distinct characteristics:

SpeciesProtein SimilarityKey DifferencesFunctional Implications
C. albicans>90% sequence identitySubtle variations in C-terminal domainPotential differences in protein interaction network
S. cerevisiae~40-50% identityMore divergent sequenceEstablished model for functional studies
Other Candida spp.70-85% identitySpecies-specific variationsTaxonomic identification markers
Filamentous fungi30-40% identitySubstantial divergenceDifferent evolutionary constraints

These comparisons are relevant because C. dubliniensis is frequently misidentified as C. albicans due to their phenotypic similarities . The specific differences in FCJ1 and other proteins may contribute to the distinct pathogenic profiles of these species, particularly in terms of their prevalence in different patient populations and their susceptibility to antifungal drugs .

Understanding these differences is critical for:

  • Developing species-specific diagnostic methods

  • Investigating potential species-specific drug targets

  • Elucidating the evolutionary history of mitochondrial architecture in pathogenic fungi

What is the relationship between FCJ1 dysfunction and C. dubliniensis pathogenicity?

The relationship between FCJ1 dysfunction and C. dubliniensis pathogenicity represents an emerging area of research with several hypothesized connections:

  • Metabolic adaptation: Mitochondrial function, including proper cristae organization maintained by FCJ1, is critical for metabolic flexibility during host colonization and infection. Dysfunction may alter the ability of C. dubliniensis to adapt to different nutrient environments encountered during infection.

  • Stress response: Proper mitochondrial function is essential for responding to oxidative stress, which is a key host defense mechanism. FCJ1 dysfunction could potentially alter susceptibility to host-derived reactive oxygen species.

  • Morphogenesis regulation: In C. albicans and potentially C. dubliniensis, mitochondrial function influences the yeast-to-hyphal transition, which is associated with virulence. FCJ1 dysfunction may affect this morphological switching.

  • Antifungal susceptibility: Mitochondrial proteins have been implicated in resistance to azole antifungals, which is particularly relevant given C. dubliniensis' ability to rapidly develop fluconazole resistance . FCJ1 dysfunction might contribute to altered drug susceptibility profiles.

While direct evidence linking FCJ1 to C. dubliniensis pathogenicity is limited in the current literature, these potential connections warrant further investigation, particularly given the clinical importance of understanding mechanisms underlying the emergence of this opportunistic pathogen in immunocompromised populations .

What are the challenges in expressing and purifying functional recombinant C. dubliniensis FCJ1?

Expression and purification of functional recombinant C. dubliniensis FCJ1 presents several technical challenges:

  • Membrane protein solubility:

    • FCJ1 naturally associates with mitochondrial membranes

    • Expression in E. coli often leads to inclusion body formation

    • Solution: Optimize solubilization conditions or use specialized membrane protein expression systems

  • Proper folding:

    • Eukaryotic protein expressed in prokaryotic system lacks appropriate chaperones

    • Potential misfolding affects functional studies

    • Solution: Consider expression in eukaryotic systems (yeast, insect cells) or refolding protocols

  • Post-translational modifications:

    • Fungal-specific modifications absent in E. coli expression

    • May affect protein-protein interactions and function

    • Solution: Expression in yeast systems closer to native environment

  • Protein stability:

    • Tendency to aggregate when removed from membrane environment

    • Challenge for long-term storage and functional assays

    • Solution: Optimize buffer conditions with appropriate detergents or membrane mimetics

  • Functional verification:

    • Lack of simple activity assays for structural proteins like FCJ1

    • Difficult to confirm if recombinant protein retains native function

    • Solution: Develop interaction assays with known binding partners

Addressing these challenges requires systematic optimization of expression conditions, purification protocols, and functional characterization approaches to ensure that the recombinant protein adequately represents the native FCJ1 for research applications.

How can researchers use recombinant FCJ1 to develop diagnostic tools for C. dubliniensis?

Recombinant C. dubliniensis FCJ1 protein offers several avenues for developing improved diagnostic tools to address the challenge of distinguishing C. dubliniensis from C. albicans :

  • Antibody-based detection systems:

    • Generate FCJ1-specific antibodies targeting unique epitopes

    • Develop ELISA or lateral flow assays for clinical samples

    • Implementation strategy: Map epitopes unique to C. dubliniensis FCJ1 not present in C. albicans homolog

  • Mass spectrometry identification markers:

    • Identify FCJ1-derived peptides as species-specific biomarkers

    • Incorporate into existing clinical MS platforms

    • Validation approach: Test against diverse clinical isolates to confirm specificity

  • Aptamer-based detection:

    • Select DNA/RNA aptamers with specificity for C. dubliniensis FCJ1

    • Develop aptamer-based biosensors for rapid detection

    • Optimization focus: Minimize cross-reactivity with C. albicans proteins

  • Functional screening assays:

    • Exploit biochemical differences between C. dubliniensis and C. albicans FCJ1

    • Develop activity-based probes for specific detection

    • Challenge: Identifying functional differences amenable to assay development

Current diagnostic challenges include the phenotypic similarity between C. dubliniensis and C. albicans, with studies showing that approximately 2% of isolates from healthy individuals and 17% of isolates from HIV-infected individuals originally identified as C. albicans were actually C. dubliniensis . Improved diagnostics would address this significant clinical challenge and enhance epidemiological surveillance, which is particularly important given C. dubliniensis' association with fluconazole resistance .

What are the recommended experimental controls when working with recombinant C. dubliniensis FCJ1?

Rigorous experimental design for recombinant C. dubliniensis FCJ1 research requires appropriate controls:

  • Protein quality controls:

    • Negative control: Buffer-only conditions to assess background signals

    • Positive control: Commercial His-tagged protein of similar size/structure

    • Stability control: Time-course analysis of protein under experimental conditions

  • Species-specificity controls:

    • C. albicans FCJ1 homolog to assess cross-reactivity

    • Other Candida species FCJ1 proteins for comparative analyses

    • Implementation: Include in binding studies, immunological assays, and functional tests

  • Functional controls:

    • Denatured FCJ1 to distinguish specific vs. non-specific interactions

    • FCJ1 mutants with altered functional domains

    • Verification method: Parallel testing under identical conditions

  • Expression system controls:

    • E. coli host cell lysate without FCJ1 expression

    • Non-specific His-tagged protein to control for tag effects

    • Analysis approach: Subtract background signals in quantitative assays

  • Application-specific controls:

    • For structural studies: Well-characterized protein standards

    • For interaction studies: Known binding and non-binding partners

    • For immunological assays: Pre-immune serum and isotype controls

Implementation of these controls enhances result reliability and facilitates troubleshooting when unexpected outcomes occur.

What methods can be used to study protein-protein interactions involving C. dubliniensis FCJ1?

Multiple complementary approaches can effectively investigate protein-protein interactions involving C. dubliniensis FCJ1:

  • Co-immunoprecipitation (Co-IP):

    • Leverage His-tag for pulldown experiments

    • Verify interactions with putative MICOS complex components

    • Strengths: Relatively straightforward, can detect native complexes

    • Limitations: May not detect weak or transient interactions

  • Yeast Two-Hybrid (Y2H):

    • Screen for novel interaction partners

    • Map interaction domains through truncation constructs

    • Strengths: High-throughput capability, in vivo context

    • Limitations: High false positive rate, nuclear localization requirement

  • Surface Plasmon Resonance (SPR):

    • Quantitative measurement of binding kinetics

    • Determine affinity constants for FCJ1 interactions

    • Strengths: Real-time analysis, label-free detection

    • Limitations: Requires protein immobilization, potential surface effects

  • Proximity-based labeling:

    • BioID or APEX2 fusion to FCJ1 for in vivo interaction mapping

    • Identify proximity partners in native context

    • Strengths: Captures transient interactions, works in native environment

    • Limitations: Identifies proximity not necessarily direct interaction

  • Crosslinking Mass Spectrometry (XL-MS):

    • Map interaction interfaces at amino acid resolution

    • Identify structural constraints for modeling

    • Strengths: Detailed structural information, captures transient interactions

    • Limitations: Technical complexity, data analysis challenges

MethodTime RequirementTechnical DifficultyInformation YieldCost
Co-IP++++++
Y2H++++++++++
SPR+++++++++++
Proximity Labeling+++++++++++++
XL-MS++++++++++++++++

Selection of appropriate methods should be guided by specific research questions, available resources, and required level of detail.

How can researchers distinguish between direct and indirect effects of FCJ1 on mitochondrial function?

Distinguishing between direct and indirect effects of FCJ1 on mitochondrial function requires a multi-faceted experimental approach:

  • Structure-function analysis:

    • Generate targeted mutations in specific FCJ1 domains

    • Assess effects on distinct mitochondrial parameters

    • Analysis strategy: Identify separable functions through domain-specific mutations

  • Temporal control systems:

    • Implement rapid protein depletion methods (e.g., auxin-inducible degron)

    • Monitor time-course of effects following FCJ1 depletion

    • Interpretation framework: Immediate effects (0-30 minutes) likely direct; delayed effects (hours-days) likely indirect

  • Biochemical reconstitution:

    • Purified component systems with defined composition

    • Systematic addition/removal of interaction partners

    • Validation approach: Confirm in vitro observations in cellular context

  • Proximity-restricted enzyme complementation:

    • Split enzyme reporters fused to FCJ1 and potential targets

    • Spatial restriction of functional readouts

    • Application: Distinguishes effects based on physical proximity

  • Comparative systems analysis:

    • Parallel studies in different fungi with conserved and divergent FCJ1 functions

    • Correlation of sequence variation with functional differences

    • Analytical focus: Identify conserved direct functions vs. species-specific indirect effects

How should researchers interpret contradictory results from different FCJ1 functional assays?

When faced with contradictory results from different FCJ1 functional assays, researchers should implement a systematic approach to resolution:

  • Technical validation:

    • Verify protein quality and experimental conditions

    • Implement additional controls to identify artifacts

    • Perform independent replication with protocol modifications

  • Context-dependent analysis:

    • Assess if contradictions reflect different experimental contexts

    • Consider buffer conditions, protein tags, expression systems

    • Systematically test variable parameters to identify critical factors

  • Integration framework:

    • Develop a hierarchical model of evidence reliability

    • Weight results based on methodological strengths/limitations

    • Construct testable hypotheses to explain apparent contradictions

  • Resolution strategy matrix:

Contradiction TypeInvestigation ApproachResolution Strategy
In vitro vs. in vivoTest intermediate complexity systemsBridge gap with ex vivo approaches
Structural vs. functionalStructure-function mutationsMap specific domains to functions
Species-specific differencesComparative analysis across fungiIdentify evolutionary context
Concentration-dependent effectsDose-response experimentsDetermine physiological relevance
  • Collaborative validation:

    • Engage independent laboratories for confirmation

    • Implement standardized protocols across research groups

    • Conduct blind analysis of shared samples

This approach acknowledges that contradictory results often reflect biological complexity rather than experimental error, potentially revealing important insights about context-dependent FCJ1 functions.

What statistical approaches are most appropriate for analyzing FCJ1 interaction data?

Analysis of FCJ1 interaction data requires appropriate statistical frameworks tailored to the experimental approach:

  • For high-throughput screening data:

    • False Discovery Rate (FDR) control for multiple testing

    • Bayesian scoring methods to rank interaction confidence

    • Implementation: Calculate q-values and interaction confidence scores

    • Example application: Yeast two-hybrid or mass spectrometry interaction screens

  • For quantitative binding assays:

    • Non-linear regression for binding kinetics

    • Statistical comparison of fitted parameters (Kd, Bmax)

    • Implementation: F-test for model comparison, extra sum-of-squares F test

    • Example application: Surface plasmon resonance or microscale thermophoresis

  • For co-localization studies:

    • Spatial statistics (Manders' coefficient, Pearson's correlation)

    • Randomization tests to establish significance thresholds

    • Implementation: Compare observed vs. randomized distribution

    • Example application: Fluorescence microscopy of FCJ1 with binding partners

  • For comparative interaction studies:

    • ANOVA with post-hoc testing for multiple conditions

    • Paired analyses for before/after comparisons

    • Implementation: Tukey's HSD for all pairwise comparisons

    • Example application: Comparing FCJ1 interactome across conditions

  • For systems-level network analysis:

    • Graph theory metrics (betweenness centrality, clustering)

    • Enrichment analysis for functional interpretation

    • Implementation: Comparison to random networks, GO term enrichment

    • Example application: Integrating FCJ1 into mitochondrial protein interaction networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.