Recombinant Candida dubliniensis Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Candida dubliniensis Golgi to ER Traffic Protein 1 (GET1) is a protein component of the guided entry of tail-anchored proteins (GET) pathway, which is crucial for the biogenesis of tail-anchored (TA) membrane proteins in eukaryotes . TA proteins play essential roles in various cellular processes, and their correct insertion into the endoplasmic reticulum (ER) membrane is vital for their function . The GET pathway ensures that these proteins are properly targeted and inserted into the ER membrane .

GET1 Function and Structure

GET1, along with GET2, forms a receptor complex in the ER membrane that captures TA proteins . Specifically, GET1/GET2 complex serves as a membrane receptor for Get3, facilitating the insertion of tail-anchored proteins into the ER membrane .

The GET1/GET2 complex exhibits significant cooperation between its subunits, which is essential for capturing and remodeling the targeting complex . This cooperation is critical for the efficient insertion of TA proteins into the ER membrane .

GET Pathway

The GET pathway is responsible for the insertion of TA proteins into the ER membrane . This process involves several key steps:

  1. Recognition and Targeting: The Get3 protein recognizes and binds to TA proteins in the cytosol .

  2. ER targeting: The Get3-TA protein complex is then targeted to the ER membrane .

  3. Insertion: The Get1/Get2 receptor complex in the ER membrane facilitates the insertion of the TA protein into the lipid bilayer .

GET1 in Different Organisms

The GET pathway and its components, including GET1, are highly conserved across different organisms . Homologs of GET1 have been identified in yeast, plants, and mammals, underscoring the importance of this pathway in eukaryotic cells . For example, in Arabidopsis, the GET system includes homologs of yeast and mammalian GET pathway components, as shown in the table below .

Table 1: Arabidopsis homologs of GET system components in yeast and mammals

Yeast GeneMammalian GeneArabidopsis GenePredicted Function
Get1WRBAt4g16444Subunit of the membrane insertase complex
Get2CAMLSubunit of the membrane insertase complex
Get3TRC40At1g01910TA substrate targeting factor
Get4TRC35At5g63220Subunit of the pretargeting complex
Get5Ubl4AAt1g55060Subunit of the pretargeting complex
Sgt2SGTAAt4g08320Subunit of the pretargeting complex
Bag6Bag6Subunit of the pretargeting complex

Implications in Diseases

The disruption of ER-to-Golgi trafficking, which involves proteins like GET1, has been linked to various neurological diseases . Efficient ER-to-Golgi transport is crucial for maintaining cellular homeostasis, and defects in this process can lead to the development of neurological disorders .

Recombinant GET1

Recombinant GET1, such as the Candida dubliniensis GET1, is produced using recombinant DNA technology . This involves expressing the GET1 protein in a host organism, such as E. coli, and then purifying the protein for use in research and other applications . Recombinant GET1 proteins often include a His-tag to facilitate purification .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET1; CD36_15290; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Target Names
GET1
Target Protein Sequence
MLLPDLHPYTILLSIFIVLLLKQLVASIGKSTIKEFVWLVYLKVSSNQSIKTYNSKQHEL HETNKEKRAISAQDEYAKWTKLNRQADKLSAELQKLNQEIQQQKASIDKVSNALLLVLTT LPIWVARVLYRNTHLFYIRQGIFPKYVEWVLALPFLPNGAVGLTIWMFAVNSVVSNFAFL VSFPFAKKVSKPVRDTKIE
Uniprot No.

Target Background

Function

Recombinant Candida dubliniensis Golgi to ER traffic protein 1 (GET1) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

Intermediate Research Questions

  • What are the optimal expression systems for producing recombinant C. dubliniensis GET1?

Multiple expression systems have been successfully employed for producing recombinant C. dubliniensis GET1, each with distinct advantages:

Expression SystemFormatAdvantagesLimitationsReference
BaculovirusPartial proteinHigh yield of eukaryotic post-translational modificationsMore complex setup, higher cost
E. coliFull-length proteinSimple, cost-effective, high yieldMay lack some eukaryotic modifications

For optimal expression in E. coli systems:

  • Utilize an N-terminal 10xHis tag for efficient purification

  • Express in systems optimized for membrane proteins

  • Culture at lower temperatures (16-18°C) after induction to increase proper folding

  • Use specialized detergents for extraction from membranes

For baculovirus expression:

  • The system produces protein with >85% purity as measured by SDS-PAGE

  • Storage recommendations include keeping aliquots at -20°C/-80°C with 50% glycerol for stability

  • Avoid repeated freeze-thaw cycles that can diminish activity

The choice of expression system should be guided by the specific experimental requirements, including whether post-translational modifications are critical for the planned analyses.

  • How can recombinant GET1 be used in in vitro membrane insertion assays?

Recombinant GET1 is an essential component for reconstituting the TA protein insertion pathway in vitro. Methodological approaches include:

  • Proteoliposome Reconstitution:

    • Prepare liposomes using defined lipid compositions (typically at 20 mg/mL)

    • Reconstitute purified GET1 and GET2 into these liposomes using detergent removal strategies

    • These proteoliposomes serve as artificial ER membranes for insertion assays

  • In Vitro Insertion Assay Components:

    • Recombinant GET3 loaded with a TA protein substrate

    • GET1/2 proteoliposomes

    • ATP to regulate the interaction cycle

    • Buffer systems that mimic physiological conditions

  • Quantitative Measurement Techniques:

    • Fluorescence-based assays using labeled TA proteins

    • Protection assays where successful insertion shields TA proteins from proteolytic degradation

    • Single-molecule techniques to observe individual insertion events

These reconstituted systems have been instrumental in demonstrating that a single GET1/2 heterodimer is sufficient for TA protein insertion, with the cytosolic regions of GET1 and GET2 binding asymmetrically to opposing subunits of the GET3 homodimer .

  • What are the common challenges in purifying functional recombinant GET1?

Purifying functional GET1 presents several technical challenges due to its nature as a transmembrane protein:

  • Membrane Protein Solubilization:

    • Requires careful selection of detergents that maintain native structure

    • Common detergents include n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Detergent concentration must be optimized to avoid protein denaturation

  • Maintaining Structural Integrity:

    • Transmembrane domains tend to aggregate in aqueous solutions

    • Addition of stabilizers like glycerol (typically 15-50%) helps maintain functionality

    • Storage at -20°C/-80°C is recommended for long-term stability

  • Functional Assessment Challenges:

    • Difficult to verify proper folding using standard techniques

    • Activity often must be assessed through binding studies with GET3 or reconstitution assays

    • Protein may lose activity after repeated freeze-thaw cycles

  • Expression Level Limitations:

    • Overexpression can lead to inclusion body formation

    • Toxicity to expression hosts when expressed at high levels

    • May require specialized expression strains or controlled induction

To overcome these challenges, researchers often use strategies like step-gradient purification, fusion tags that enhance solubility, and careful buffer optimization throughout the purification process.

  • How does GET1 interact with GET2 to form the receptor complex?

GET1 and GET2 form a heterodimeric complex in the ER membrane that serves as the receptor for GET3-TA protein complexes. Their interaction involves:

  • Complex Architecture:

    • Single-molecule and bulk fluorescence measurements have established that a single GET1/GET2 heterodimer is sufficient for functional TA protein insertion

    • The transmembrane domains of both proteins interact to form a stable complex in the membrane

  • Functional Domains:

    • GET2 has flexible cytosolic "hooks" that initially capture the GET3-TA complex

    • GET1 has cytosolic domains that interact with GET3 to trigger conformational changes and TA protein release

    • The transmembrane regions provide membrane anchoring and proper orientation

  • Binding Mechanism:

    • GET2 makes first contact with the GET3-TA complex through its cytosolic domains

    • A "handoff" mechanism transfers the GET3-TA complex from GET2 to GET1

    • GET1 binding causes a partial "unzipping" of GET3, opening the TA protein binding groove and facilitating release

  • Recycling Mechanism:

    • After TA protein release, ATP binding to GET3 causes it to adopt a closed conformation

    • This conformational change facilitates GET3 release from GET1, allowing the cycle to repeat

This coordinated interaction between GET1 and GET2 ensures efficient delivery and insertion of TA proteins into the ER membrane.

  • What experimental approaches can be used to study GET1-GET3 interactions?

Several experimental techniques have been employed to characterize the interactions between GET1 and GET3:

TechniqueApplicationKey InsightsReference
In vitro binding assaysDirect protein-protein interaction measurementDemonstrates direct binding between GET1 and GET3
Fluorescence resonance energy transfer (FRET)Real-time interaction dynamicsCan reveal conformational changes during binding
Reconstituted proteoliposome systemsFunctional assessment of interactionsShows GET1's role in membrane recruitment of GET3
Structural studies (X-ray crystallography, cryo-EM)Atomic-level interaction detailsReveals binding interfaces and conformational changes
Mutagenesis analysisIdentification of critical residuesDetermines which amino acids are essential for interaction

When studying these interactions, researchers have established that:

  • GET1 binding to GET3 triggers conformational changes that facilitate TA protein release

  • This interaction is ATP-independent but is influenced by the ATP-binding state of GET3

  • The cytosolic domain of GET1 is sufficient for GET3 binding in in vitro assays

  • GET1 binds to GET3 in a manner that causes the GET3 dimer to partially "unzip," opening the TA protein binding groove

Advanced Research Questions

  • How do mutations in GET1 affect TA protein insertion efficiency?

Mutations in GET1 can significantly impact TA protein insertion efficiency, with consequences that vary depending on the specific mutation and its location within the protein:

  • Transmembrane Domain Mutations:

    • Can disrupt proper anchoring in the ER membrane

    • May affect GET1-GET2 heterodimer formation

    • Result in mislocalization of GET1 and consequent failure of the receptor complex

  • Cytosolic Domain Mutations:

    • Disrupt GET3 binding and the conformational changes needed for TA protein release

    • Key residues involved in GET3 interaction are particularly sensitive

    • Can result in normal recruitment but failed insertion of TA proteins

  • Functional Consequences:

    • Complete GET1 deletion leads to cytosolic aggregation of GET3-TA complexes

    • In Δget1 cells, broad defects in TA protein biogenesis are observed

    • Some TA proteins may be misdirected to mitochondria in the absence of functional GET1

  • Biochemical Analysis:

    • In vitro reconstitution systems with mutant GET1 show reduced rates of TA protein insertion

    • The severity of the defect correlates with the importance of the mutated residues in GET3 binding

    • Some mutations may affect specific subsets of TA proteins more than others

These findings highlight the critical role of specific GET1 domains and residues in the proper functioning of the GET pathway and suggest potential targets for manipulating this pathway experimentally.

  • What is the stoichiometry of the GET1/GET2 complex in membrane bilayers?

The stoichiometry of the GET1/GET2 complex has been a subject of intensive investigation, with important insights emerging from studies using fluorescence-based techniques:

  • Current Evidence:

    • Single-molecule and bulk fluorescence measurements have definitively shown that a single GET1/GET2 heterodimer is sufficient for functional TA protein insertion

    • This 1:1 stoichiometry contradicts earlier models that proposed higher-order oligomeric complexes

  • Experimental Approaches:

    • Reconstituted proteoliposomes with controlled protein:lipid ratios

    • Single-molecule fluorescence measurements using specifically labeled GET1 and GET2

    • Quantitative in vitro insertion analysis correlating insertion efficiency with receptor density

  • Functional Implications:

    • The 1:1 heterodimer interacts with the GET3 homodimer, with GET1 and GET2 binding to opposite subunits of GET3

    • This arrangement allows for the coordinated "handoff" mechanism where GET2 first captures the GET3-TA complex and then transfers it to GET1

    • The asymmetric binding is critical for the conformational changes in GET3 required for TA protein release

This defined stoichiometry provides a simplified model for understanding how GET1/GET2 and GET3 coordinate TA protein insertion and forms the basis for more detailed mechanistic studies of this process.

  • How do the cytosolic domains of GET1 and GET2 coordinate binding to GET3?

The cytosolic domains of GET1 and GET2 play distinct but coordinated roles in binding GET3 and facilitating TA protein insertion:

  • Asymmetric Binding:

    • The conserved cytosolic regions of GET1 and GET2 bind asymmetrically to opposing subunits of the GET3 homodimer

    • This arrangement allows for a coordinated sequence of events during TA protein delivery and insertion

  • GET2 Cytosolic Domain Function:

    • Contains flexible "hooks" that capture the GET3-TA complex in the cytosol

    • Makes initial contact with GET3, bringing it to the vicinity of the ER membrane

    • Acts like "Dr. Octopus" with long, flexible arms that can reach out into the cytosol

  • GET1 Cytosolic Domain Function:

    • Binds to GET3 in a manner that induces conformational changes

    • Causes GET3 to partially "unzip," which opens the TA protein binding groove

    • This conformational change triggers release of the TA protein for membrane insertion

  • Coordinated Mechanism:

    • GET2 makes initial contact and brings GET3-TA to the membrane

    • A "handoff" occurs where GET3-TA is transferred from GET2 to GET1

    • GET1 binding causes conformational changes in GET3 that release the TA protein

    • ATP binding to GET3 causes it to adopt a closed conformation and release from GET1

    • This completes the cycle and allows GET3 to participate in another round of TA protein delivery

This coordinated binding mechanism ensures efficient transfer of TA proteins from the cytosolic chaperone GET3 to the ER membrane for insertion.

  • What are the differences in GET1 regulation between C. dubliniensis and C. albicans?

While both C. dubliniensis and C. albicans possess the GET pathway, several differences in regulation and function may exist:

  • Genetic Context:

    • C. dubliniensis and C. albicans are closely related species but differ in their virulence and adaptation to the human host

    • Differences in GET1 regulation may contribute to these phenotypic variations

  • Gene Expression Patterns:

    • Similar to differences observed with the transcriptional repressor NRG1, GET1 expression and regulation may differ between the two species under various environmental conditions

    • These differences could affect TA protein targeting efficiency and cellular adaptation

  • Functional Impact:

    • The GET pathway affects various cellular processes including protein trafficking, mitochondrial function, and stress responses

    • Differences in GET1 regulation between species could contribute to C. albicans' greater virulence compared to C. dubliniensis

  • Genetic Diversity:

    • C. dubliniensis has been shown to have four distinct genotypes within the species

    • These genotypic variations may impact GET1 function or regulation across different C. dubliniensis strains

  • Evolutionary Adaptation:

    • Differences in GET1 regulation may reflect evolutionary adaptations to different ecological niches

    • While C. albicans is a more successful pathogen, C. dubliniensis shows distinct population structures that correlate with host status (HIV-infected vs. HIV-negative)

Further comparative studies specifically focused on GET1 regulation between these species would be valuable for understanding how this pathway may contribute to their different pathogenic potentials.

  • How does GET1 function relate to C. dubliniensis virulence and pathogenicity?

The relationship between GET1 function and C. dubliniensis virulence involves several interconnected factors:

  • Cell Wall Integrity:

    • Proper targeting of tail-anchored proteins is critical for maintaining cell wall structure and function

    • Disruptions in the GET pathway could affect cell wall composition and integrity, similar to what has been observed with other proteins like BST1 in C. albicans

  • Stress Response and Adaptation:

    • The GET pathway affects cellular responses to environmental stresses

    • C. dubliniensis exhibits microevolution in response to stressors, which could involve adaptations in GET1 function or regulation

  • Host-Pathogen Interactions:

    • GET1's role in proper protein targeting affects cellular processes involved in host interaction

    • C. dubliniensis shows reduced virulence compared to C. albicans, which may partly reflect differences in protein trafficking pathways

  • Genotypic Variations:

    • The four distinct genotypes identified in C. dubliniensis populations may display differences in GET1 function or regulation

    • Genotype 1 is associated with HIV-infected individuals, while genotypes 2-4 are more common in HIV-negative individuals, suggesting potential adaptations to different host environments

  • Potential for Targeted Interventions:

    • Understanding GET1 function in C. dubliniensis could provide insights for developing antifungal strategies

    • Targeting pathways essential for proper protein localization could disrupt pathogen viability or virulence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.