Recombinant Candida dubliniensis Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET2; CD36_09180; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Target Names
GET2
Target Protein Sequence
MSEPVVDTAELSAEEKKRLLRERRQAKMSKGKATARLNNILSQGSSVKTSGVKSVLDQEK EATSSHDDDPEIQDITEITTPPPRTPPIGEDAPQDIDKIFQTMLQQQQQRGQGANTADDP FAQIMKMFNQTEGPDSLINEGSASTQDPTEIKYHQELLEYNTYNQKLWKFRFLLVRVLVT LFNFFYHYTSISDFHASNYAYVRDLSSEEYPVRDFFTWFATSEVVLVAAYYSVFHSLGLF HAANQNSIILKVMSMGSMILPQLESYKPLVARFLGYYELLGIVLGGLSLVIVLFGLLSFA N
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET1, it functions as a membrane receptor for soluble GET3. GET3 recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins possessing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Candida dubliniensis and how does it differ from Candida albicans?

Candida dubliniensis is a pathogenic yeast in the genus Candida that was first characterized in 1995. While closely related to Candida albicans, it exhibits distinct phenotypic and genotypic characteristics, including differences in putative virulence traits that may explain the varying spectrum of diseases caused by these species . C. dubliniensis causes fewer infections in humans and demonstrates reduced virulence and filamentation in animal infection models compared to C. albicans .

The differences between these species include differential regulation of key genes such as the transcriptional repressor NRG1, which accounts for altered host-cell interactions. C. dubliniensis exhibits reduced ability to downregulate NRG1 expression in response to environmental signals that typically promote filamentation in C. albicans, contributing to its reduced virulence and capacity to cause host cell damage .

What is the function of Golgi to ER trafficking proteins in Candida species?

Golgi to ER trafficking proteins, including those potentially analogous to GET2, play critical roles in retrograde transport, which is essential for maintaining cellular homeostasis. In yeast systems, proteins such as Dsl1p function primarily in retrograde Golgi-to-ER traffic, with defects in this system leading to secondary disruptions in anterograde trafficking .

These trafficking proteins typically form multiprotein complexes that facilitate vesicle movement between organelles. For instance, Dsl1p exists in a complex with Tip20p (~80 kDa) and likely Sec20p (~50 kDa), both of which are ER-localized proteins that bind to the ER t-SNARE Ufe1p . This complex formation suggests that GET2 in C. dubliniensis might similarly participate in protein complexes that mediate retrograde transport.

How is protein trafficking connected to pathogenicity in Candida species?

The relationship between protein trafficking and pathogenicity in Candida species is multifaceted. Efficient protein trafficking systems are necessary for adaptation to different host environments, secretion of virulence factors, and response to stress conditions encountered during infection.

Research indicates that mutations affecting ER-Golgi trafficking can significantly impact virulence characteristics. For example, the transcriptional regulator NRG1 affects C. dubliniensis' ability to damage host tissues in infection models, suggesting that the regulation of protein expression and trafficking contributes to pathogenicity . Additionally, proteins involved in retrograde trafficking may influence the cell's ability to process misfolded proteins, as efficient ER degradation requires a fully competent early secretory pathway .

What molecular genetic systems are available for studying C. dubliniensis?

Researchers have developed sophisticated molecular genetic systems for C. dubliniensis that facilitate genetic manipulation and functional studies. One established system employs the dominant selection marker MPA(R) from C. albicans, which confers resistance to mycophenolic acid (MPA), enabling transformation of C. dubliniensis wild-type strains .

This transformation system has been successfully used to integrate reporter genes such as GFP under the control of inducible promoters like the C. albicans SAP2 promoter into the C. dubliniensis genome. Importantly, this research demonstrates that the GFP reporter gene can be functionally expressed in C. dubliniensis and that C. albicans promoters can be used for controlled gene expression in C. dubliniensis . These tools provide a foundation for genetic manipulation studies, including those focused on GET2 and other trafficking proteins.

How can researchers accurately identify and differentiate C. dubliniensis from C. albicans?

Accurate identification of C. dubliniensis is essential for research validity. A duplex real-time PCR assay has been developed for rapid detection and differentiation between clinical C. albicans and C. dubliniensis isolates. This method utilizes two species-specific primer pairs and SYBR Green dye to differentiate the species through melting curve analysis of real-time PCR amplicons .

The technique yields distinct melting temperature profiles, with reference strains of C. albicans and C. dubliniensis exhibiting melting temperatures of 86.55°C and 82.75°C, respectively . This approach does not require prior identification of clinical yeast isolates as C. albicans/C. dubliniensis by germ tube formation and provides results within 2 hours. For resource-limited settings without access to real-time PCR equipment, detection of amplicons by agarose gel electrophoresis serves as an alternative confirmation method .

What approaches can be used to visualize protein localization in C. dubliniensis?

Fluorescent protein tagging represents a powerful approach for visualizing protein localization in C. dubliniensis. Research has demonstrated that GFP reporter genes can be functionally expressed in this organism, allowing for in vivo tracking of proteins . When constructing such reporter systems, researchers should consider:

  • Selection of appropriate promoters, such as the C. albicans SAP2 promoter, which has been shown to function in C. dubliniensis for controlled gene expression

  • Transformation methods utilizing selection markers like MPA(R)

  • Confirmation of successful transformants through fluorescence detection under appropriate inducing conditions

For GET2 localization studies, this approach would involve creating fusion constructs with GFP and integrating them into the C. dubliniensis genome. Similar approaches have been used to visualize TLO proteins in C. albicans, revealing their localization to the nucleus and in some cases to mitochondria as well .

How do mutations in retrograde trafficking proteins affect cellular function in yeast?

Mutations in retrograde trafficking proteins have profound effects on cellular processes in yeast systems. Studies with Dsl1p, a protein involved in Golgi-to-ER retrograde traffic, have shown that mutations in this protein cause defects in retrograde trafficking even under conditions where no anterograde transport defects are evident . This suggests that proteins involved in retrograde transport, potentially including GET2, have primary functions in retrograde processes, with disruptions leading to secondary defects in forward trafficking.

These findings have significant implications for GET2 research, suggesting that targeted mutations in this protein might reveal its specific roles in C. dubliniensis. Researchers should consider designing experiments that can distinguish between primary retrograde defects and secondary consequences in other trafficking pathways when characterizing GET2 function.

What is the relationship between ER-Golgi trafficking and protein degradation?

The relationship between ER-Golgi trafficking and protein degradation represents a critical aspect of cellular quality control. Research indicates that efficient degradation of misfolded proteins in yeast requires a fully functional early secretory pathway . Mutations in proteins essential for ER-Golgi protein traffic severely inhibit ER degradation of model substrates like CPY* .

This interdependence suggests that GET2 and other trafficking proteins may play roles beyond simple transport, potentially contributing to protein quality control mechanisms. Researchers investigating GET2 should consider:

  • How GET2 disruption might affect degradation of misfolded proteins

  • Whether GET2 interacts with components of the ER-associated degradation (ERAD) machinery

  • How retrograde trafficking contributes to maintaining ER homeostasis during stress conditions

Such investigations could reveal multifunctional aspects of GET2 beyond its primary trafficking role.

How can protein-protein interactions of GET2 be characterized in C. dubliniensis?

Characterizing the protein interaction network of GET2 in C. dubliniensis would provide valuable insights into its function and regulation. Based on studies of related trafficking proteins, several approaches are recommended:

  • Immunoprecipitation followed by mass spectrometry: This approach has successfully identified interacting partners of trafficking proteins like Dsl1p, revealing its association with Tip20p and potentially Sec20p .

  • Yeast two-hybrid screening: While technically challenging in non-conventional yeasts, this method could identify direct binding partners of GET2.

  • Co-localization studies using differentially tagged proteins: This approach allows visualization of potential interactions in living cells.

  • Genetic interaction screens: Systematic analysis of genetic interactions can reveal functional relationships between GET2 and other cellular components.

When designing such experiments, researchers should consider that trafficking proteins often function in multiprotein complexes, and interactions may be transient or dependent on specific cellular conditions.

What expression systems are optimal for producing recombinant C. dubliniensis GET2?

Selecting an appropriate expression system for recombinant C. dubliniensis GET2 production requires careful consideration of protein characteristics and experimental objectives. Several options exist:

  • Homologous expression in C. dubliniensis: Using the molecular genetic systems developed for C. dubliniensis, GET2 could be expressed with affinity tags under control of inducible promoters like the C. albicans SAP2 promoter . This approach maintains the native cellular environment but may yield lower protein amounts.

  • Expression in S. cerevisiae: As a well-characterized yeast with established expression tools, S. cerevisiae offers advantages for producing eukaryotic membrane-associated proteins. The genetic tractability and availability of numerous compatible vectors make this an attractive option.

  • Heterologous expression in E. coli: While potentially higher-yielding, prokaryotic expression may present challenges for proper folding and post-translational modifications of eukaryotic trafficking proteins.

Each system presents different advantages and limitations regarding yield, post-translational modifications, protein folding, and functional activity. The selection should be guided by the specific requirements of downstream applications.

What purification strategies are effective for membrane-associated trafficking proteins?

Purifying membrane-associated trafficking proteins like GET2 presents distinct challenges. Based on approaches used for similar proteins, the following strategies are recommended:

  • Detergent solubilization: Careful selection of detergents is critical for maintaining protein structure and function. Mild non-ionic detergents like digitonin, DDM, or CHAPS are often suitable starting points.

  • Affinity chromatography: N- or C-terminal affinity tags (His, FLAG, or Strep) can facilitate purification, but tag placement should be optimized to minimize interference with protein function.

  • Size exclusion chromatography: This technique helps separate the target protein from contaminants and can provide information about complex formation.

  • For protein complexes: Consider tandem affinity purification (TAP) approaches to isolate intact complexes, similar to how Dsl1p complexes were isolated .

  • Native extraction conditions: Since trafficking proteins like Dsl1p can be extracted from membranes in multiprotein complexes , optimizing extraction conditions to maintain these interactions may be valuable for functional studies.

When developing purification protocols, researchers should systematically optimize each step while monitoring protein activity or structural integrity to ensure that the purified protein remains functionally relevant.

How can the functional activity of recombinant GET2 be assessed?

Assessing the functional activity of recombinant GET2 requires approaches that reflect its native role in retrograde trafficking. Several complementary methods can be employed:

  • In vitro vesicle budding/fusion assays: Reconstituted systems using purified components can assess GET2's role in specific steps of vesicle trafficking.

  • Complementation studies: Expressing recombinant GET2 in yeast strains with GET2 mutations or deletions can determine if the recombinant protein restores normal function.

  • Protein-protein interaction assays: Pull-down assays or surface plasmon resonance can verify interactions with known binding partners.

  • Localization studies: Fluorescently tagged recombinant GET2 should localize correctly to the ER membrane if properly folded and functional.

  • Cell-based trafficking assays: Monitoring the movement of cargo proteins between the Golgi and ER in cells expressing wild-type versus mutant GET2 can provide functional insights.

These approaches should be adapted based on the specific aspects of GET2 function being investigated and the experimental system employed.

How might GET2 function influence C. dubliniensis virulence?

Understanding how GET2 function might influence C. dubliniensis virulence requires considering the broader context of protein trafficking in pathogenicity. While direct evidence for GET2's role in virulence is limited, several mechanisms can be proposed:

  • Stress adaptation: Proper retrograde trafficking is essential for cellular responses to stress conditions encountered during infection. If GET2 plays a similar role to other trafficking proteins, its dysfunction could compromise stress adaptation.

  • Protein quality control: The link between ER-Golgi trafficking and protein degradation suggests that GET2 might influence the cell's ability to maintain proteostasis during infection.

  • Secretion of virulence factors: Efficient trafficking between the ER and Golgi is necessary for proper processing and secretion of virulence factors. Disruptions in this system could alter the pathogen's ability to damage host tissues.

Research with related species provides contextual evidence. For example, in C. albicans, the expanded TLO gene family, which encodes Med2-like Mediator complex components, is thought to enhance adaptability to different host niches . Similar adaptability mechanisms might involve trafficking proteins like GET2.

How does C. dubliniensis's reduced virulence correlate with differences in protein trafficking?

The reduced virulence of C. dubliniensis compared to C. albicans correlates with several molecular differences, including potential variations in protein trafficking systems. Studies indicate that C. dubliniensis exhibits reduced filamentation and host cell damage, partly due to differences in transcriptional regulation .

The NRG1 transcriptional repressor, which influences hypha formation and host cell interactions, is regulated differently in the two species. C. dubliniensis cannot modulate NRG1 expression in response to the same environmental signals that promote filamentation in C. albicans . This regulatory difference could influence the expression of trafficking proteins, including potentially GET2, affecting the cell's ability to adapt to host environments.

Additionally, the expansion of the TLO gene family in C. albicans (14 expressed copies compared to fewer in related species) correlates with increased virulence and clinical prevalence . These TLO proteins, which have domains similar to Med2 and function in transcription regulation, may influence the expression of trafficking machinery components, creating species-specific differences in protein trafficking efficiency.

What experimental models are appropriate for studying GET2's role in pathogenicity?

Selecting appropriate experimental models for studying GET2's role in C. dubliniensis pathogenicity requires consideration of both cellular and host-pathogen interaction aspects:

  • Cell culture models:

    • Macrophage co-culture: Studies with NRG1 mutants demonstrated enhanced filamentation and survival of C. dubliniensis in macrophage co-culture , making this a valuable model for assessing GET2's role in immune evasion.

    • Reconstituted human oral epithelium: This model can assess tissue damage capacity, as demonstrated with NRG1 deletion strains .

  • Animal models:

    • Systemic infection models: While NRG1 deletion did not affect C. dubliniensis virulence in systemic mouse models , GET2 might influence different aspects of pathogenicity that could be detected in such models.

    • Mucosal infection models: These may be more relevant for studying C. dubliniensis, which is frequently isolated from oral candidosis in immunocompromised patients.

  • Molecular genetic approaches:

    • GET2 deletion or conditional mutants: Using the established molecular genetic systems for C. dubliniensis , researchers can create targeted GET2 mutants to assess phenotypic changes.

    • Reporter strain systems: Fluorescent reporters can monitor GET2 expression and localization under different infection-relevant conditions.

When designing experiments, researchers should consider the specific aspects of pathogenicity they wish to investigate and select models that can best reveal GET2's contributions to these processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.