Recombinant Candida dubliniensis High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Recombinant SHO1 is produced in E. coli systems for research applications:

ParameterSpecification
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstitution in Tris/PBS buffer with glycerol
ApplicationsAntibody production, enzymatic assays, structural studies

This recombinant tool has been utilized to:

  • Study antifungal drug targets linked to osmotic stress pathways .

  • Develop diagnostic assays for invasive candidiasis by detecting anti-SHO1 antibodies .

Comparative Analysis with Saccharomyces cerevisiae SHO1

C. dubliniensis SHO1 shares functional similarities with S. cerevisiae SHO1 but differs in regulatory roles:

FeatureC. dubliniensis SHO1S. cerevisiae SHO1
OsmosensingCritical for HOG pathway activation Essential for glycerol biosynthesis
MorphogenesisLinked to hyphal development No direct role in yeast morphology
Clinical RelevanceVirulence factor in candidiasis Laboratory model for stress signaling

Research Gaps and Future Directions

  • Functional Validation: Direct knockout studies in C. dubliniensis are needed to confirm SHO1’s role in virulence .

  • Structural Biology: Cryo-EM or X-ray crystallography could resolve its transmembrane signaling mechanism .

  • Therapeutic Targeting: Screening SHO1 inhibitors may yield novel antifungals .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SHO1; CD36_08610; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Target Names
SHO1
Target Protein Sequence
MGFSLLNFTGDPFAISTVSFGIMSWVVAIAGAASSKQQTFPHFSWWGISYQIVIILIIFV LYANNNIELYKFTLVGLVSIAFIYTTNSTNNLIYNSNSPGNLCCAAGCILLSILNLIWIL YFGGHPESPTNQFIDSFSIRGQGHEQLGSGSHNHNHNLNNANTNTNTNMPLGGGNGIIGK SELSPYDDRFASPINISGGTNQPTSESLRLASVGQMGNGPFSNTTGNPNLQQPLTGSFGG STNHTPTNANTNTNTTTTNNNNNNTGYMTSSHLTGLENFSSPNVPNNGIGLTRDLTHNSN SLNNNSHNGATGSINNSNNTNKRNTIYTDSETGTGITFRYKAKALYSYDANPDDINEISF VKDEILEVDDIDGKWWQARRANGQVGICPSNYVKLLDT
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the SHO1 protein in Candida dubliniensis?

SHO1 is an adaptor protein that functions as an important element of the high-osmolarity glycerol (HOG) mitogen-activated protein (MAP) kinase pathway in Candida species. In pathogenic yeasts, SHO1 serves as a crucial link between oxidative stress responses, cell wall biogenesis, and morphogenesis processes. The protein is structurally similar to that found in Saccharomyces cerevisiae, where it was first characterized as part of the stress response system. Based on studies in related Candida species, SHO1 in C. dubliniensis likely functions as a transmembrane osmosensor that detects environmental stresses and triggers appropriate cellular responses .

How does C. dubliniensis SHO1 differ from its C. albicans counterpart?

While both proteins share significant sequence homology and functional roles, there are subtle differences that reflect their species-specific adaptations. In C. albicans, SHO1 has been demonstrated to be sensitive to oxidative stress and plays a minor role in transmitting phosphorylation signals to the Hog1 MAP kinase in response to this stress. The primary signal in C. albicans occurs through the Sln1-Ssk1 branch of the HOG pathway. Both C. dubliniensis and C. albicans SHO1 proteins are involved in cell wall structure maintenance, as demonstrated by sensitivity to cell wall interfering compounds like Congo red and calcofluor white when the gene is mutated . Given their close phylogenetic relationship, C. dubliniensis SHO1 likely shares many of these properties but may have unique characteristics related to its ecological niche.

What is the genetic organization of the SHO1 gene in C. dubliniensis?

The SHO1 gene in C. dubliniensis is part of the genome that exhibits significant similarity to C. albicans. Based on comparative studies, we know that C. dubliniensis contains multiple genotypes, with the majority of clinical isolates belonging to ITS genotype 1. Unlike some genes in C. dubliniensis such as CdCDR1 (which often contains a nonsense mutation in genotype 1 isolates), the SHO1 gene is generally intact and functional across different strains . The gene encodes a transmembrane protein that contains functional domains necessary for interaction with downstream signaling components of the HOG pathway.

How does SHO1 interact with other components of the HOG pathway in C. dubliniensis?

In C. dubliniensis, as in related Candida species, SHO1 functions as one of the upstream branches of the HOG pathway. The protein likely interacts with MAPKKK and MAPKK components to transduce stress signals. Based on studies in C. albicans, SHO1 has a limited role in transmitting oxidative stress signals to Hog1 MAPK, with the main signaling occurring through the Sln1-Ssk1 branch. Interestingly, genetic analyses in C. albicans revealed that double ssk1 sho1 mutants could still grow on high-osmolarity media and activate Hog1, indicating alternative inputs to the pathway exist . This complexity suggests that C. dubliniensis SHO1 functions within a redundant network, where multiple sensors can detect and respond to environmental stresses.

How does SHO1 contribute to C. dubliniensis pathogenicity?

The pathogenicity of C. dubliniensis is linked to its ability to adapt to host environments and undergo morphological transitions. SHO1's role in sensing environmental stress and regulating cell wall biogenesis makes it an important contributor to virulence. In C. albicans, SHO1 is essential for the activation of Cek1 MAPK under conditions requiring active cell growth and cell wall remodeling . Additionally, sho1 mutants in C. albicans show defective morphogenesis on media that stimulate hyphal growth, such as SLAD and Spider media . These findings suggest that C. dubliniensis SHO1 likely contributes to pathogenicity by enabling adaptation to host conditions and facilitating morphological transitions necessary for tissue invasion and immune evasion.

What are the optimal conditions for expressing recombinant C. dubliniensis SHO1 protein?

Based on similar recombinant protein production systems, the optimal expression of C. dubliniensis SHO1 would typically involve using E. coli as an expression host with a histidine tag for purification . The protein should be expressed with consideration of its full-length sequence (similar to other fungal SHO1 proteins) to preserve functional domains. Expression conditions would typically involve induction at mid-log phase, followed by growth at lower temperatures (16-25°C) to enhance proper folding of the protein. After expression, purification can be performed using immobilized metal affinity chromatography (IMAC) due to the His-tag, followed by further purification steps such as size exclusion chromatography if needed.

What methods are most effective for studying SHO1 function in C. dubliniensis?

The most effective approach combines genetic manipulation with phenotypic and biochemical analyses. The creation of sho1 knockout mutants using CRISPR-Cas9 or traditional homologous recombination would be the first step. These mutants can then be characterized for their phenotypic responses to various stressors (oxidative, osmotic), cell wall disrupting agents (Congo red, calcofluor white), and morphogenesis-inducing conditions. Complementation studies with wild-type SHO1 would confirm the specificity of the observed effects. For protein interaction studies, co-immunoprecipitation and yeast two-hybrid assays can identify binding partners. Phosphorylation of downstream MAPK components (like Hog1 and Cek1) can be monitored by Western blotting with phospho-specific antibodies to assess signal transduction efficiency .

How can researchers distinguish between C. dubliniensis and C. albicans in experimental settings?

Several methods can effectively differentiate these closely related species. Molecular identification using PCR with species-specific primers targeting the ITS regions provides definitive identification. The C. dubliniensis-specific probe Cd25 can be used in hybridization assays . Phenotypically, C. dubliniensis can be distinguished by its inability to grow at 45°C, whereas C. albicans can. CHROMagar Candida medium also shows differential coloration, though this is not always reliable. More specific approaches include indirect immunofluorescence with C. dubliniensis blastospore-specific polyvalent antiserum and DNA fingerprinting analysis . In research settings where mixed cultures might be present, these methods should be combined for accurate species identification.

What are the implications of the C. dubliniensis CDR1 gene mutation for SHO1 function research?

A significant finding in C. dubliniensis is that 58% of genotype 1 isolates harbor a nonsense mutation in the CdCDR1 gene, converting codon 756 (TAT) to a TAG translational stop codon . This results in a truncated 85-kDa protein instead of the full-length 170-kDa protein. While this mutation directly affects drug resistance mechanisms, it serves as an important consideration for SHO1 research in several ways. First, it demonstrates the genetic diversity within C. dubliniensis populations that might extend to variations in SHO1. Second, when conducting experiments with multiple C. dubliniensis strains, researchers should be aware that genetic differences beyond the target gene might influence phenotypic outcomes. Third, the prevalence of naturally occurring mutations suggests the need for careful strain selection when studying SHO1 function to avoid confounding effects from other genetic variations.

How do multilocus sequence typing (MLST) approaches inform SHO1 variation studies in C. dubliniensis?

MLST has been valuable in characterizing C. dubliniensis populations and can be applied to understand SHO1 variation. Studies have identified distinct clades within C. dubliniensis, with avian-associated isolates forming a subgroup within clade C1 . The identification of diploid sequence types (DSTs) based on genotype numbers for multiple loci provides a framework for analyzing SHO1 genetic diversity. Research has shown that avian-associated isolates of C. dubliniensis contain unique genetic markers, and this approach could reveal environment-specific adaptations in SHO1 . For comprehensive analysis of SHO1 variation, researchers should consider MLST data to select representative strains from different clades and ecological niches.

What is known about SHO1 polymorphisms across C. dubliniensis populations?

While specific data on SHO1 polymorphisms in C. dubliniensis is limited in the provided search results, the existence of genetic diversity across C. dubliniensis populations suggests potential variation in SHO1. Studies have identified multiple genotypes and clades within C. dubliniensis, with distinct genetic markers in isolates from different sources, including avian-associated strains . Given this population structure, SHO1 likely exhibits sequence variations that could impact protein function or regulation. Research into other genes like CdCDR1 has revealed significant polymorphisms affecting protein function , suggesting that similar variations might exist in SHO1. Comprehensive sequencing of the SHO1 gene across diverse C. dubliniensis isolates would be necessary to fully characterize its polymorphic nature.

What domains of the C. dubliniensis SHO1 protein are critical for its signal transduction function?

Based on studies of SHO1 in related species, the C. dubliniensis SHO1 protein likely contains several crucial functional domains. These include transmembrane domains that anchor the protein in the cell membrane and are essential for sensing environmental changes, an SH3 (Src Homology 3) domain that mediates protein-protein interactions with downstream components of the signaling pathway, and possibly mucin-like domains involved in environmental sensing . The SH3 domain, typically located at the C-terminus, is particularly important for binding to proline-rich motifs in target proteins such as MAPKKKs. Mutation studies in related fungi have shown that alterations in these domains significantly impact signal transduction efficiency and stress response capabilities.

How does the amino acid sequence of C. dubliniensis SHO1 compare to orthologs in other fungal species?

While detailed sequence comparison data for C. dubliniensis SHO1 is not directly provided in the search results, we can infer based on related research that it shares significant homology with orthologs in other Candida species, particularly C. albicans. The SHO1 protein in C. albicans functions in stress response and morphogenesis , suggesting evolutionary conservation of these functions. Sequence alignment would likely reveal higher conservation in functional domains such as the SH3 domain and transmembrane regions, with greater divergence in less functionally constrained regions. Comparative analysis with more distant fungi like Saccharomyces cerevisiae and Paracoccidioides brasiliensis would show more substantial differences, reflecting the evolutionary distance between these species and potentially specialized adaptations to different ecological niches.

What post-translational modifications regulate SHO1 activity in C. dubliniensis?

Post-translational modifications (PTMs) are likely critical regulators of SHO1 function in C. dubliniensis, though specific details are not provided in the search results. Based on studies in related fungi, potential PTMs include phosphorylation, which can alter protein conformation and interaction capabilities, and ubiquitination, which may regulate protein turnover and thus signal duration. In stress response pathways, rapid regulation through PTMs is often essential for timely adaptation. Research in C. albicans has shown that the HOG pathway is regulated by phosphorylation cascades , suggesting that SHO1 may be similarly regulated. Investigation of these modifications would require techniques such as mass spectrometry, phospho-specific antibodies, and mutagenesis of potential modification sites to determine their functional significance.

How can recombinant C. dubliniensis SHO1 be used in antifungal drug development research?

Recombinant C. dubliniensis SHO1 protein offers several applications in antifungal drug research. As a key component of stress response pathways and morphogenesis regulation, SHO1 represents a potential target for novel antifungals with mechanisms distinct from current drugs. The recombinant protein can be used in high-throughput screening assays to identify small molecules that disrupt SHO1 interactions with downstream signaling components. Structure-based drug design approaches, utilizing the recombinant protein for crystallography studies, could enable the development of specific inhibitors. Additionally, the protein can serve as an antigen for developing diagnostic antibodies that distinguish between Candida species. Since SHO1 functions in pathways essential for virulence and stress adaptation, targeting this protein could lead to antifungals that reduce pathogenicity without necessarily killing the organism, potentially reducing selection pressure for resistance.

What is the relationship between SHO1 and biofilm formation in C. dubliniensis?

While specific data on SHO1's role in C. dubliniensis biofilm formation is not directly provided in the search results, we can infer based on its functions in related processes. SHO1's involvement in cell wall biogenesis, morphogenesis, and stress responses suggests a likely role in biofilm development . In C. albicans, sho1 mutants show altered cell wall structure and defects in morphogenesis on various media , both of which are processes critical for biofilm formation. Biofilms require proper cell adhesion (mediated by cell wall components) and often involve hyphal growth, areas where SHO1 has demonstrable functions. Future research should specifically examine how SHO1 mutations affect C. dubliniensis biofilm characteristics, including biomass, architecture, matrix composition, and resistance to antifungals, as biofilms represent a significant clinical challenge in Candida infections.

How does environmental adaptation affect SHO1 expression and function in different C. dubliniensis isolates?

Environmental adaptation appears to influence genetic diversity in C. dubliniensis, potentially affecting SHO1. Studies have identified distinct genetic markers in avian-associated isolates compared to human isolates, suggesting niche-specific adaptations . The SHO1 protein, given its role in stress response and environmental sensing, is likely subject to selection pressures in different habitats. Research has shown that C. dubliniensis isolates from avian sources form a distinct genetic subgroup, with unique diploid sequence types (DSTs) . This suggests that SHO1 expression levels, sequence variations, or regulatory mechanisms might differ between isolates from different environments. Comparative transcriptomic and proteomic analyses of isolates from diverse sources could reveal how environmental factors shape SHO1 expression and function, providing insights into adaptive mechanisms of this opportunistic pathogen.

What is the amino acid composition and biochemical properties of purified recombinant C. dubliniensis SHO1?

Based on comparable recombinant fungal proteins, the biochemical properties of recombinant C. dubliniensis SHO1 would typically include:

PropertyExpected Value for C. dubliniensis SHO1
Molecular WeightApproximately 30-35 kDa (core protein without modifications)
Isoelectric Point (pI)Typically 5.5-6.5 for membrane-associated signaling proteins
SolubilityModerate (requires detergents for full solubilization due to transmembrane domains)
StabilityModerately stable at 4°C; storage at -20°C/-80°C recommended with glycerol
Post-translational ModificationsPotential phosphorylation sites on serine/threonine residues
Functional DomainsSH3 domain (C-terminal), Multiple transmembrane domains

For optimal experimental use, the recombinant protein should be maintained in a buffer system that preserves its native conformation, typically containing low concentrations of non-ionic detergents for stability of transmembrane regions .

How do C. dubliniensis SHO1 expression levels correlate with stress response phenotypes?

While direct experimental data correlating C. dubliniensis SHO1 expression with stress phenotypes is not provided in the search results, research on related species offers insights. In C. albicans, sho1 mutants show sensitivity to oxidative stress and cell wall interfering compounds like Congo red and calcofluor white . This suggests that SHO1 expression levels likely correlate positively with resistance to these stressors in C. dubliniensis as well. The relationship between SHO1 and stress response appears complex, as SHO1 contributes to multiple pathways. Based on C. albicans studies, we would expect that strains with higher SHO1 expression would show enhanced tolerance to cell wall stress and more robust morphogenetic responses, while being minimally affected in oxidative stress responses (which primarily depend on the Sln1-Ssk1 pathway) . Quantitative analysis correlating expression levels with stress tolerance would require techniques such as RT-qPCR for transcript measurement and standardized phenotypic assays.

What is the distribution of SHO1 genetic variations across C. dubliniensis isolates from different ecological niches?

Based on genetic diversity studies of C. dubliniensis isolates, we can construct a representative table of potential SHO1 variation patterns:

Source of IsolatesNumber of IsolatesPredominant GenotypeUnique Genetic MarkersReference
Human Clinical36ITS genotype 1Various DSTs within clade C1
Avian-associated (Great Saltee Island)11ITS genotype 1Novel exZWF1b alleles, DST 31 predominant
Avian-associated (Dublin)3ITS genotype 1DST 27 found in one isolate

All avian-associated isolates (14/14) possessed the TAG polymorphism in the CDR1 gene, compared to only 53% (19/36) of human isolates . This differential distribution of genetic markers suggests that SHO1 may similarly exhibit niche-specific variations that could affect its function or regulation, though specific SHO1 sequence data across these populations would be needed to confirm this hypothesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.