Recombinant Candida dubliniensis Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Candida dubliniensis Probable Endonuclease LCL3 (LCL3)

Recombinant Candida dubliniensis Probable Endonuclease LCL3 (LCL3) is a protein derived from the yeast species Candida dubliniensis . C. dubliniensis is an opportunistic fungal pathogen known for causing oral candidiasis, particularly in immunocompromised individuals . LCL3 is a probable endonuclease, an enzyme that cleaves nucleic acid chains .

Characteristics of Candida dubliniensis

  • Prevalence: C. dubliniensis is often found in the oral cavities of HIV-infected individuals and AIDS patients .

  • Differentiation: C. dubliniensis can be distinguished from other Candida species through phenotypic and genetic characteristics .

  • Resistance: C. dubliniensis can develop fluconazole resistance, an important consideration in treatment strategies .

Genetic and Molecular Features

Genetic studies have played a crucial role in identifying and characterizing C. dubliniensis .

  • DNA Fingerprinting: DNA fingerprinting studies using probes like 27A reveal distinct patterns for C. dubliniensis compared to C. albicans .

  • rRNA Gene Sequences: Analysis of rRNA gene sequences provides a basis for phylogenetic studies and differentiating C. dubliniensis from other Candida species .

  • Electrophoretic Karyotype Analysis: Electrophoretic karyotyping patterns show unique chromosome-sized bands in C. dubliniensis isolates, aiding in their identification .

  • Genotypes: Different genotypes of C. dubliniensis can be identified using specific restriction endonuclease cleavage sites and genotype-specific primer pairs .

Recombinant LCL3 Protein Details

Recombinant LCL3 is produced using recombinant DNA technology, which involves introducing the gene encoding LCL3 into a host organism for expression and purification .

  • Source Organism: Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841)

  • UniProt Accession Number: B9W9Z5

  • Amino Acid Sequence: The protein consists of 235 amino acids with the following sequence: MPPIPPDPTESISIFHPKVILLSAGVTTSLFFGYKFYKRYIRRIKTYLDLTPTIIENNTKLYGYVTRVGDGDNFRFYHTPGGWIFGWGWLRKIPTTRKDLKDETLMIRLCGVDAPEGAHFGKPAQPFSKEALHWLREYVDGKYVTITPYSIDQYKRVVARAQIWKWTGKKDISAEmLKVGYAIVYEGKAEAEFGDNEDWYRKLESRAKLLRKGVWSLGKNLTTPGEFKRIHYRGE

  • Molecular Weight: Approximately 26.9 kDa (estimated)

  • Tag Information: The tag type is determined during the production process .

  • Purity: Greater than 90% by SDS-PAGE (estimated)

  • Storage: Recommended storage at -20℃, with aliquots at 4℃ for up to one week; repeated freezing and thawing should be avoided .

  • Buffer: Typically stored in a Tris-based buffer with 50% glycerol, optimized for protein stability .

Applications of Recombinant LCL3

Recombinant LCL3 has potential applications in research and diagnostics related to Candida dubliniensis .

  • ELISA Assays: Recombinant LCL3 can be used in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting antibodies against C. dubliniensis or for quantifying LCL3 protein levels .

  • Research Tool: Useful in studying the enzymatic activity, structure, and function of the LCL3 endonuclease .

  • Diagnostic Development: Can be employed in developing diagnostic tools for identifying C. dubliniensis infections .

Experimental Methods for Candida dubliniensis Identification

Several methods are employed to identify C. dubliniensis in clinical and research settings .

  • Culture Media: Use of CHROMagar Candida medium to screen clinical samples . C. dubliniensis colonies typically appear dark green after 48 hours of incubation .

  • Germ Tube and Chlamydospore Production: Isolates are tested for their ability to produce germ tubes and chlamydospores .

  • Growth at 42°C: C. dubliniensis grows poorly or not at all at 42°C, which helps differentiate it from C. albicans .

  • Intracellular β-Glucosidase Activity: Testing for the lack of intracellular β-glucosidase activity is a reliable method for distinguishing C. albicans and C. dubliniensis .

  • Coaggregation Assay: Testing the CoAg ability of C. dubliniensis isolates with anaerobic oral bacteria like Fusobacterium nucleatum .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LCL3; CD36_12760; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Target Names
LCL3
Target Protein Sequence
MPPIPPDPTESISIFHPKVILLSAGVTTSLFFGYKFYKRYIRRIKTYLDLTPTIIENNTK LYGYVTRVGDGDNFRFYHTPGGWIFGWGWLRKIPTTRKDLKDETLMIRLCGVDAPEGAHF GKPAQPFSKEALHWLREYVDGKYVTITPYSIDQYKRVVARAQIWKWTGKKDISAEMLKVG YAIVYEGKAEAEFGDNEDWYRKLESRAKLLRKGVWSLGKNLTTPGEFKRIHYRGE
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Candida dubliniensis and why is it significant for research?

Candida dubliniensis is a recently described species of chlamydospore- and germ tube-positive yeast primarily recovered from the oral cavities of HIV-infected individuals and AIDS patients. The organism has been isolated from patients in widespread geographic locations, with its phenotypic and genotypic characteristics well-documented in recent literature. Its clinical significance stems from its involvement in oral candidiasis, particularly erythematous candidiasis, and its potential to develop resistance to fluconazole rapidly. C. dubliniensis may represent part of a significant epidemiological shift in Candida species causing infections, coinciding with a relative decrease in C. albicans infections compared to other Candida species . The study of C. dubliniensis proteins, including endonucleases like LCL3, is essential for understanding its biology, pathogenicity mechanisms, and potential therapeutic targets.

What is the probable function of endonuclease LCL3 in Candida dubliniensis?

The probable endonuclease LCL3 (LCL3) in Candida dubliniensis is classified with the Enzyme Commission number EC= 3.1.-.- indicating its role in hydrolase activity acting on ester bonds . Based on its sequence characteristics and classification, LCL3 likely functions in nucleic acid metabolism, potentially participating in DNA repair mechanisms, recombination processes, or RNA processing. The protein contains domains characteristic of endonucleases that cleave phosphodiester bonds within nucleic acid chains. Its specific amino acid sequence (as documented in UniProt B9W9Z5) suggests it may have specialized functions in genomic maintenance or stress response in C. dubliniensis. Understanding this enzyme's function is crucial for researchers investigating fungal nucleic acid metabolism and potential novel antifungal targets.

How is Candida dubliniensis distinguished from similar Candida species, especially C. albicans?

Although closely related to C. albicans, C. dubliniensis can be distinguished using several reliable phenotypic and genetic characteristics. A recommended laboratory procedure involves initial screening by plating samples on CHROMagar Candida medium at 37°C, where C. dubliniensis produces dark green colonies after 48 hours of incubation. Isolates producing germ tubes and chlamydospores are then tested for growth at 42°C on Potato Dextrose Agar (PDA). C. dubliniensis either fails to grow or grows poorly at 42°C, unlike C. albicans . Definitive identification can be achieved by testing for intracellular β-glucosidase activity, which C. dubliniensis lacks—a stable phenotypic trait that reliably differentiates it from C. albicans . For confirmation, DNA fingerprinting techniques can be employed, including restriction fragment length polymorphism analysis with HinfI digestion or RAPD (Random Amplified Polymorphic DNA) analysis, which are effective, rapid, and relatively easy to perform.

What expression systems are recommended for producing recombinant LCL3 protein?

For recombinant expression of C. dubliniensis LCL3, researchers should consider several expression systems depending on the experimental requirements. E. coli-based systems (particularly BL21(DE3) strains) offer high yield and cost-effectiveness for initial structural and functional studies. For proper post-translational modifications, eukaryotic systems such as Pichia pastoris or Saccharomyces cerevisiae are recommended. The full-length protein sequence of LCL3 (amino acids 1-235) contains regions that may require proper folding only achieved in eukaryotic systems . Optimization protocols should include testing various induction conditions (temperature, inducer concentration, and duration) and fusion tags (His, GST, or MBP) to enhance solubility. For functional studies requiring native conformation, baculovirus expression systems in insect cells might provide superior results despite higher cost and complexity. Each expression strategy should be validated through Western blotting and activity assays to confirm proper expression and folding.

How can researchers effectively purify recombinant LCL3 for in vitro studies?

Purification of recombinant LCL3 requires a multi-step approach to ensure high purity and retention of enzymatic activity. Based on the protein characteristics, an effective purification protocol would include: (1) Initial clarification of cell lysate by centrifugation (15,000 × g, 30 min at 4°C); (2) Affinity chromatography utilizing the specific tag incorporated during expression (e.g., immobilized metal affinity chromatography for His-tagged proteins); (3) Ion-exchange chromatography to remove contaminants based on LCL3's theoretical isoelectric point; (4) Size exclusion chromatography as a polishing step to obtain homogeneous protein and remove aggregates. Throughout purification, protein stability should be maintained using Tris-based buffers with 50% glycerol as indicated in storage recommendations . Activity assays measuring endonuclease function should be performed after each purification step to track retention of enzymatic function. For long-term storage, the purified protein should be aliquoted to avoid repeated freeze-thaw cycles and stored at -20°C or -80°C for extended preservation of activity.

What are the optimal conditions for assessing LCL3 endonuclease activity in vitro?

To assess LCL3 endonuclease activity, researchers should establish assays that measure nucleic acid cleavage under controlled conditions. Based on the protein's characteristics, an optimal reaction buffer would likely contain 20-50 mM Tris-HCl (pH 7.5-8.0), 50-100 mM NaCl, 1-5 mM MgCl₂ or MnCl₂ as divalent cation cofactors, and 1 mM DTT to maintain reducing conditions. Activity can be monitored using gel-based assays with supercoiled plasmid DNA or synthesized oligonucleotide substrates with fluorescent labels. Reaction kinetics should be measured at various temperatures (25°C, 30°C, and 37°C) to determine optimal conditions, with time course experiments ranging from 5 minutes to 60 minutes. Products can be analyzed by agarose or polyacrylamide gel electrophoresis, with quantification of substrate disappearance or product formation. For precise kinetic parameters, researchers should determine Km, Vmax, and kcat using varying substrate concentrations. Inhibition studies with metal chelators (EDTA) or varying ionic strengths can further characterize the enzyme's requirements for activity.

How might LCL3 contribute to the pathogenicity and virulence of Candida dubliniensis?

The potential role of LCL3 in C. dubliniensis pathogenicity represents an intriguing research direction. As a probable endonuclease, LCL3 may contribute to virulence through several mechanisms: (1) DNA repair capabilities that enhance survival under host-induced oxidative stress; (2) Involvement in genetic recombination processes that facilitate adaptation to host environments; (3) Potential role in biofilm formation, which is critical for C. dubliniensis persistence in clinical settings. The increasing incidence of C. dubliniensis infections, particularly in immunocompromised patients, suggests that virulence factors like LCL3 may play important roles in pathogenesis . Research approaches to investigate this relationship include: generating LCL3 knockout strains and assessing their virulence in mouse infection models; comparing LCL3 expression levels between invasive and commensal isolates; and examining LCL3 expression under various stress conditions mimicking the host environment (oxidative stress, antifungal exposure, nutrient limitation). Understanding LCL3's contribution to virulence could provide insights into novel therapeutic approaches targeting this enzyme.

What are potential applications of LCL3 in studying antifungal resistance mechanisms?

C. dubliniensis exhibits concerning patterns of fluconazole resistance, with clinical isolates demonstrating reduced susceptibility and susceptible isolates rapidly developing resistance in vitro . LCL3, as a nucleic acid processing enzyme, may play indirect roles in resistance development through genome maintenance or stress response pathways. Researchers investigating antifungal resistance can utilize recombinant LCL3 in several experimental designs: (1) Expression analysis comparing LCL3 levels in susceptible versus resistant isolates; (2) Chromatin immunoprecipitation studies to identify genomic regions where LCL3 binds during stress response; (3) Protein interaction studies to map LCL3's position in cellular networks activated during antifungal exposure. Additionally, inhibitor screening against LCL3 activity might identify compounds that sensitize resistant strains to existing antifungals. The increasing prevalence of C. dubliniensis in clinical settings, coupled with its ability to rapidly develop resistance, makes research into proteins like LCL3 particularly relevant for addressing emerging antifungal resistance challenges.

How can structural biology approaches enhance our understanding of LCL3 function?

Structural characterization of LCL3 would significantly advance our understanding of its enzymatic mechanism and substrate specificity. Researchers should consider multiple structural approaches, including X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy depending on protein properties. For crystallization, purified LCL3 (>95% homogeneity) should be screened against commercial crystallization condition kits at various protein concentrations (5-15 mg/ml). Co-crystallization with substrate analogs or catalytically-inactive mutants with bound substrate could provide insights into the catalytic mechanism. For function prediction, in silico structural models can be generated using homology modeling against related endonucleases with known structures. Molecular dynamics simulations could then predict substrate binding modes and catalytic residues. Site-directed mutagenesis of predicted catalytic residues (based on sequence analysis and the amino acid sequence provided ) followed by activity assays would validate these predictions. Understanding LCL3's structure-function relationship would contribute to comprehending its role in C. dubliniensis biology and potentially identify unique features for targeted inhibitor development.

What are common challenges in expressing and purifying active recombinant LCL3?

Researchers working with recombinant LCL3 may encounter several technical challenges. First, protein solubility issues can arise due to improper folding, particularly in bacterial expression systems. This can be addressed by optimizing expression conditions (reduced temperature to 16-20°C, lower inducer concentration) or using solubility-enhancing fusion partners like MBP or SUMO. Second, proteolytic degradation during expression or purification may occur; adding protease inhibitors throughout the purification process and minimizing processing time can mitigate this issue. Third, maintaining enzymatic activity during purification presents challenges as endonucleases may lose activity due to oxidation or cofactor loss. Including reducing agents (1-5 mM DTT or 0.5-2 mM β-mercaptoethanol) and appropriate metal ions in purification buffers can preserve activity. Finally, protein yield may be insufficient for structural studies; optimization through codon-optimization of the expression construct, testing multiple expression systems, or scaling up culture volumes may be necessary. For each challenge, systematic troubleshooting with proper controls is essential for developing reproducible protocols.

How can researchers verify the identity and activity of purified recombinant LCL3?

Verification of recombinant LCL3 identity and activity requires a multi-faceted approach. For identity confirmation, researchers should perform: (1) SDS-PAGE analysis to verify molecular weight matches the expected 235 amino acid protein ; (2) Western blot analysis using tag-specific antibodies or custom antibodies against LCL3 peptides; (3) Mass spectrometry analysis (LC-MS/MS) to confirm the amino acid sequence matches the expected sequence from C. dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) . For activity verification, functional assays demonstrating endonuclease activity should include: (1) Gel-based nuclease assays using different nucleic acid substrates (supercoiled DNA, linear DNA, RNA); (2) Fluorescence-based real-time nuclease assays with quenched fluorescent substrates; (3) Comparison of wild-type activity with site-directed mutants of predicted catalytic residues. Control experiments should include heat-inactivated enzyme and reactions in the presence of EDTA to chelate metal cofactors. These verification steps ensure that experimental results can be confidently attributed to authentic LCL3 activity.

What considerations are important when designing experiments to compare LCL3 with homologous proteins from other Candida species?

Comparative studies between LCL3 and homologous proteins from other Candida species require careful experimental design. First, sequence alignment analysis should identify true homologs based on sequence conservation, domain architecture, and phylogenetic relationships. Key species for comparison include C. albicans (the most pathogenic and prevalent Candida species), C. glabrata, and C. krusei, which like C. dubliniensis have emerged as increasingly important pathogens . When expressing recombinant proteins for comparison, identical expression systems, tags, and purification methods should be used to minimize technical variables. Enzymatic characterization should include standardized assays measuring: substrate specificity patterns, kinetic parameters (Km, kcat, kcat/Km), pH and temperature optima, and cofactor requirements. For structural comparisons, circular dichroism spectroscopy can provide initial insights into secondary structure differences before pursuing higher-resolution techniques. Functional differences identified through these comparative approaches may correlate with species-specific pathogenicity traits and could illuminate unique aspects of C. dubliniensis biology compared to other Candida species that have been more extensively studied.

How can recombinant LCL3 be used in developing diagnostic tools for Candida dubliniensis infections?

The development of rapid, accurate diagnostic tools for C. dubliniensis infections represents an important clinical need, particularly given the organism's increasing prevalence and potential for fluconazole resistance . Recombinant LCL3 could be leveraged in diagnostic development through several approaches: (1) Generation of specific anti-LCL3 antibodies for immunoassay-based detection methods; (2) Development of PCR or isothermal amplification assays targeting the LCL3 gene, which may contain unique sequences distinguishing it from homologs in other Candida species; (3) Mass spectrometry-based approaches incorporating LCL3 peptide signatures into clinical diagnostic algorithms. When designing such diagnostic tools, researchers should consider the epidemiological data showing C. dubliniensis presence in 27% of HIV-infected individuals and 32% of AIDS patients with clinical symptoms of oral candidiasis . Performance validation should include testing against clinical isolates from diverse anatomical sites beyond oral specimens, as C. dubliniensis has been recovered from blood, vaginal, urinary, and fecal specimens . Comparative analyses with current identification methods would establish whether LCL3-based diagnostics offer advantages in speed, sensitivity, or specificity.

What ecological and epidemiological questions about C. dubliniensis can be addressed using LCL3-specific reagents?

LCL3-specific reagents (antibodies, nucleic acid probes, or activity-based probes) could facilitate novel ecological and epidemiological investigations of C. dubliniensis. Such reagents would enable researchers to address several important questions: (1) What is the true global prevalence of C. dubliniensis in various patient populations beyond the well-documented Irish cohorts? (2) How does LCL3 expression change during colonization versus active infection states? (3) Are there correlations between LCL3 sequence variants and geographic distribution or clinical outcomes? Methodological approaches could include developing LCL3-specific immunohistochemistry protocols for tissue samples, creating PCR-based surveillance tools for environmental and clinical screening, and establishing reporter systems to monitor LCL3 expression in vivo. These approaches could help clarify whether the apparent increasing incidence of C. dubliniensis represents a true epidemiological shift or improved detection methods . Additionally, LCL3-based studies could investigate whether specific host factors influence C. dubliniensis proliferation, potentially explaining the organism's apparent predilection for HIV-infected individuals and other immunocompromised patients.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.