Recombinant Candida dubliniensis Probable metalloreductase AIM14 (AIM14)

Shipped with Ice Packs
In Stock

Description

Introduction to Metalloreductases in Candida Species

Metalloreductases are critical enzymes involved in metal ion homeostasis, redox reactions, and pathogenicity in fungal species. Candida dubliniensis, a close relative of C. albicans, expresses AIM14, a probable metalloreductase implicated in iron metabolism. Recombinant AIM14 enables biochemical and structural studies to elucidate its role in fungal survival and drug resistance .

Molecular Characterization of Recombinant C. dubliniensis AIM14

Recombinant AIM14 is produced in heterologous systems (e.g., E. coli, yeast) for functional studies. Key features include:

ParameterDetails
Gene NameAIM14 (CD36_18260)
Protein LengthFull-length or partial constructs (e.g., 1–551 aa in C. tropicalis homolog)
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purification≥85% purity (SDS-PAGE), His-tagged for affinity chromatography
StorageLyophilized powder in Tris/PBS buffer with trehalose; stable at -80°C

Sequence Features:

  • Contains conserved ferric reductase domains (FRD) linked to NADH/NADPH oxidase activity .

  • Predicted transmembrane regions critical for metal ion transport .

Functional Role and Biochemical Properties

AIM14 functions as a ferric-chelate reductase, facilitating iron acquisition via reductive uptake:

  • Converts Fe³⁺ to Fe²⁺ for cellular import, a process vital for virulence in pathogenic fungi .

  • Associates with divalent metal transporters (e.g., Fet4, Smf1/2) to maintain iron homeostasis .

Key Functional Data:

  • Subcellular Localization: Membrane-bound, likely in the plasma or vacuolar membrane .

  • Enzymatic Activity: NADPH-dependent reduction of Fe³⁺, with optimal activity at pH 6.0–7.5 .

  • Regulation: Expression induced under iron-deficient conditions .

Phylogenetic Analysis and Evolutionary Context

AIM14 belongs to the fungal metalloreductase (fuFRE) clade, distinct from plant or bacterial homologs . Comparative analysis reveals:

SpeciesAIM14 HomologKey Features
C. dubliniensisAIM14 (CD36_18260)Linked to iron acquisition and biofilm formation
C. tropicalisAIM14 (C5M5S1)551 aa, 90% sequence identity to C. dubliniensis
Scheffersomyces stipitisFRE3.1 (AIM14)Partial structural homology; functional divergence

Evolutionary Significance:

  • Fungal metalloreductases diverged early from protist/plant homologs, adapting to host-specific iron scavenging .

  • C. dubliniensis AIM14 shares functional redundancy with C. albicans Fre6 but exhibits unique regulatory motifs .

Antifungal Resistance Studies

  • AIM14 contributes to iron-dependent pathways that enhance biofilm formation and fluconazole resistance in Candida spp. .

  • Knockout strains show reduced viability under iron-limiting conditions, highlighting its role in pathogen survival .

Diagnostic and Therapeutic Development

  • Recombinant AIM14 serves as an antigen for antibody production in serological assays .

  • Inhibitors targeting metalloreductases are under investigation to disrupt fungal iron metabolism .

Technical Considerations for Recombinant AIM14

  • Reconstitution: Requires sterile deionized water with glycerol (5–50%) for long-term stability .

  • Activity Assays: Measured via ferrozine-based Fe²⁺ detection or NADPH oxidation rates .

Unresolved Questions and Future Directions

  • Structural determination of AIM14 to map substrate-binding sites.

  • Role in zinc/copper homeostasis and cross-talk with other metal transporters .

  • Clinical relevance of AIM14 polymorphisms in drug-resistant C. dubliniensis isolates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
AIM14; CD36_18260; Probable metalloreductase AIM14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-537
Protein Length
full length protein
Species
Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Target Names
AIM14
Target Protein Sequence
MEEVVVPRHGDHHNINIKYGFFIFALTIIQTIFFLQVKFIQIKRWNSTGRFSKFWSQITN PPIWLMVTVWLLIVIFTGGHKISDFSEEYIISAKRYGRMAYCLIPLNIYLVLRPTNSPLL KPGYYLENMSLHKWTSRIIVFCSTIHAAGYVYKWIKEGAILNKPFRFLNLLGVVVFVFLV VLAIISIRPFRRKVYSTFYLIHNVTAWSMVILITFHARPGVTVFAVISLILLGYQLYLRY YSSYMVNSLKVIDIPTSTLQIIKIPQSNKFPNWLPGSHIRLNYTISKFKSWTTASHPFTV VTIPEDSTNNLTLIVRKPNSFVINPLDSYLVTGPYPSLAPPFFTTANIVNIICGGSGISL GLPIYHHFKSINSTVPVKLVWTIRNQNDTFIMNQLDMTGVQVYVTSIGDTNSEQQENQQQ AVPLFVIEEEEEEQGHGLLNNDNENGIELQNMPKTNEESSEANSTNSKNNKDNQERKEYF KFGRPKFDEVFAIDDPTTTYDLDNSWVIACGPDELISDAKRWSKDRGYRFYYEKYEM
Uniprot No.

Target Background

Function
Probable cell surface metalloreductase. May be involved in iron or copper homeostasis.
Database Links
Protein Families
Ferric reductase (FRE) family, AIM14 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Candida dubliniensis and how does it differ from Candida albicans?

Candida dubliniensis is a recently described opportunistic fungal pathogen closely related to Candida albicans but differs in its epidemiology, certain virulence characteristics, and notably, in its ability to develop fluconazole resistance in vitro. The species was primarily isolated from the oral cavities of HIV-infected individuals and AIDS patients . While C. albicans is generally considered the most pathogenic Candida species, C. dubliniensis has emerged as an important opportunistic pathogen alongside other non-albicans species like C. tropicalis, C. glabrata, and C. krusei .

Key distinguishing features include:

  • C. dubliniensis produces chlamydospores and germ tubes similar to C. albicans

  • C. dubliniensis typically fails to grow or grows poorly at 42°C on Potato Dextrose Agar (PDA)

  • C. dubliniensis lacks intracellular β-glucosidase activity, which is a stable phenotypic trait

  • C. dubliniensis colonies appear dark green after 48 hours of incubation on CHROMagar Candida medium at 37°C

For definitive identification, molecular techniques such as DNA fingerprinting with the C. albicans-specific probe 27A, restriction fragment length polymorphism analysis with HinfI digestion, or RAPD analysis are recommended .

What genetic manipulation systems are available for C. dubliniensis compared to other Candida species?

After creating these auxotrophic strains, the URA3 gene from C. albicans (CaURA3) can be used as a selection marker for targeted integration of recombinant DNA into the C. dubliniensis genome. This approach has been demonstrated to be highly efficient, with transformants obtained at high frequency and with specific integration at the desired genomic locus .

How can researchers distinguish between C. dubliniensis and other Candida species in clinical or laboratory samples?

Researchers can employ a stepwise approach to reliably distinguish C. dubliniensis from other Candida species, particularly C. albicans:

  • Initial screening on CHROMagar Candida medium at 37°C for 48 hours

  • Selection of dark green colonies for further testing

  • Verification of germ tube and chlamydospore production

  • Growth assessment at 42°C on PDA (C. dubliniensis grows poorly or not at all)

  • Testing for intracellular β-glucosidase activity (negative in C. dubliniensis)

For definitive molecular identification, researchers should consider:

  • DNA fingerprinting with C. albicans-specific probe 27A

  • Restriction fragment length polymorphism analysis with HinfI digestion

  • RAPD (Random Amplified Polymorphic DNA) analysis

This combinatorial approach ensures accurate identification, which is crucial for epidemiological studies and investigations into antifungal resistance patterns.

What expression systems are most effective for producing recombinant C. dubliniensis proteins?

For recombinant expression of C. dubliniensis proteins, several systems have been employed with varying degrees of success. The choice of expression system depends on the specific requirements for protein folding, post-translational modifications, and downstream applications.

When working with metalloreductases like AIM14, which may require metal cofactors for proper folding and activity, consideration of the expression host's capacity to incorporate these elements is crucial. Based on approaches used for related Candida proteins:

  • Homologous expression in C. dubliniensis: Using the URA3-based selection system with the target gene under control of a strong promoter such as ADH1 or TDH3 can yield proteins in their native conformation . This approach is particularly valuable when studying protein-protein interactions within the same organism.

  • Expression in S. cerevisiae: This represents a compromise between maintaining yeast-specific post-translational modifications while achieving higher protein yields than homologous expression. The genetic tools available for S. cerevisiae make this a practical choice for many fungal proteins.

  • Heterologous expression in E. coli: While offering high yield and simplicity, this system may require optimization for fungal codon usage and may not support all post-translational modifications essential for metalloreductase activity.

What are the critical factors in purifying active recombinant metalloreductases from Candida species?

Purification of active metalloreductases requires careful attention to several critical factors:

  • Buffer composition: Metalloreductases typically require specific metal ions for activity. Buffers should avoid chelating agents like EDTA that may strip essential metals, and may benefit from supplementation with the appropriate metal cofactors (Fe2+, Cu2+, Zn2+) depending on the specific metalloreductase.

  • Reducing conditions: Maintaining the redox environment is crucial for metalloreductases. Buffers with reducing agents such as DTT or β-mercaptoethanol (1-5 mM) help preserve active site cysteine residues in their reduced state.

  • pH stability: Most fungal metalloreductases function optimally in slightly acidic to neutral pH (5.5-7.5). Testing protein stability and activity across a pH range is advisable during purification protocol development.

  • Temperature considerations: C. dubliniensis proteins may exhibit temperature sensitivity different from those of C. albicans, especially given the observed growth differences at 42°C . Purification should generally be performed at 4°C to preserve activity.

  • Affinity tags: While His-tags are commonly used, their placement (N- or C-terminal) should be evaluated based on the predicted structure of the metalloreductase to avoid interfering with metal binding sites or catalytic domains.

What methods are most suitable for assessing metalloreductase activity in recombinant C. dubliniensis proteins?

Metalloreductase activity can be assessed through several complementary approaches:

  • Spectrophotometric assays: Ferric reductase activity can be measured using ferrozine, which forms a colored complex with Fe2+ but not Fe3+. The reduction of Fe3+ to Fe2+ can be monitored by measuring absorbance at 562 nm. A typical reaction mixture contains:

    • 50 mM sodium citrate buffer (pH 6.5)

    • 5% glucose

    • 1 mM ferrozine

    • 0.2 mM Fe3+-EDTA

    • Purified protein (0.1-1 μg)

  • Electron transfer assays: Using artificial electron acceptors such as DCPIP (2,6-dichlorophenolindophenol) or cytochrome c to measure electron transfer capability. The reduction of these acceptors can be monitored spectrophotometrically.

  • Metal binding assays: Techniques such as isothermal titration calorimetry (ITC) or differential scanning fluorimetry with metal titration can provide insights into metal binding affinities and stoichiometry.

  • In-gel activity staining: Following native PAGE separation, gels can be incubated with ferrozine and Fe3+ to visualize bands with metalloreductase activity as purple bands.

How can researchers integrate protein-protein interaction studies to understand the role of AIM14 in C. dubliniensis?

Understanding protein-protein interactions provides critical insights into the biological functions and regulatory mechanisms of metalloreductases. Based on approaches used for related proteins in C. albicans, researchers can employ:

  • Substrate trapping mutants: Creating catalytically inactive mutants (similar to the Cdc14 phosphatase-dead mutant approach) that still bind substrates but do not release them, allowing for the identification of interacting partners .

  • SILAC-based quantitative proteomics: Stable Isotope Labeling with Amino Acids in Cell Culture combined with affinity purification and mass spectrometry enables the discrimination between specific interactors and background proteins . This approach has successfully identified 126 proteins that interact with Cdc14 in C. albicans, of which 80% were previously unknown interactors .

  • Co-immunoprecipitation with tagged AIM14: Using epitope tags (Myc, HA, or GFP) to pull down AIM14 complexes from C. dubliniensis lysates, followed by mass spectrometry identification.

  • Yeast two-hybrid screening: While traditional yeast two-hybrid has limitations for membrane-associated proteins, split-ubiquitin based methods may be suitable for identifying AIM14 interactors.

  • Bimolecular Fluorescence Complementation (BiFC): To visualize protein interactions in living cells by tagging potential interacting partners with complementary fragments of a fluorescent protein.

What role might AIM14 play in C. dubliniensis pathogenicity and antifungal drug resistance?

Metalloreductases like AIM14 may contribute to pathogenicity and drug resistance through several mechanisms:

  • Metal acquisition during infection: Metalloreductases can facilitate iron acquisition from host proteins, a critical virulence factor. C. dubliniensis is found primarily in oral cavities of immunocompromised patients , where iron acquisition may influence colonization and persistence.

  • Oxidative stress resistance: Metalloreductases can contribute to redox homeostasis, potentially protecting against oxidative burst from host immune cells. This function may be particularly relevant in HIV-infected individuals, where C. dubliniensis is frequently isolated .

  • Drug efflux pump regulation: While not directly an efflux pump, metalloreductases may interact with or regulate efflux systems. C. dubliniensis clinical isolates have shown resistance to fluconazole, and the species can rapidly develop resistance in vitro . The association between metalloreductase activity and efflux pump expression warrants investigation, especially given the documented induction of the MDR1 efflux pump by certain drugs in C. dubliniensis .

  • Biofilm formation: Metal homeostasis plays roles in biofilm development, a key virulence factor in Candida infections. The contribution of AIM14 to this process could be assessed by comparing biofilm formation between wild-type and AIM14-deficient strains.

Research approaches should include creating AIM14 deletion mutants in C. dubliniensis using techniques similar to those described for creating ura3 mutants , followed by comprehensive phenotypic analysis under various conditions and in infection models.

How can advanced structural biology techniques be applied to understand the metal-binding and catalytic mechanisms of C. dubliniensis AIM14?

Understanding the structural basis of AIM14 function requires sophisticated structural biology approaches:

  • X-ray crystallography: Obtaining crystal structures of AIM14 in different states (apo, metal-bound, substrate-bound) provides atomic-level insights into catalytic mechanisms. Key considerations include:

    • Protein purity (>95% by SDS-PAGE)

    • Protein stability and homogeneity (assessed by differential scanning fluorimetry)

    • Screening multiple crystallization conditions (typically 500-1000 conditions)

    • Co-crystallization with metal cofactors and/or substrates

  • Cryo-electron microscopy (cryo-EM): Particularly valuable if AIM14 forms larger complexes or if crystallization proves challenging. Recent advances in single-particle cryo-EM enable high-resolution structures of proteins >100 kDa.

  • NMR spectroscopy: For studying metal binding dynamics and conformational changes in solution. 2D and 3D heteronuclear experiments with 15N/13C-labeled protein can map metal binding sites and monitor structural changes upon metal binding.

  • Molecular dynamics simulations: To model the dynamics of metal binding and substrate interactions, especially when integrated with experimental structural data.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions of conformational flexibility and solvent accessibility changes upon metal or substrate binding.

  • Site-directed mutagenesis: Guided by structural insights, key residues in metal binding or catalysis can be mutated to validate their functional importance. This approach was effectively used to create substrate-trapping mutants of Cdc14 phosphatase in C. albicans .

What are the most common challenges in generating C. dubliniensis deletion mutants for metalloreductase genes?

Generating deletion mutants in C. dubliniensis presents several challenges that researchers should anticipate:

  • Diploid genome: Like C. albicans, C. dubliniensis is diploid, requiring sequential deletion of both alleles. The MPA(R)-flipping strategy has been successfully used for this purpose . This approach involves:

    • First-round transformation targeting one allele with a selectable marker

    • FLP-mediated excision of the marker

    • Second-round transformation targeting the second allele

    • Verification of homozygous deletion by PCR and Southern blotting

  • Transformation efficiency: C. dubliniensis may exhibit different transformation efficiencies compared to C. albicans. Optimization of spheroplast preparation or electroporation protocols may be necessary. The use of homology arms of 50-100 bp has been effective for targeted integration in C. dubliniensis .

  • Phenotypic verification: Essential genes cannot be deleted homozygously. If AIM14 is essential, consider using conditional promoters like MET3 or tetracycline-regulated systems to control expression .

  • Genetic background effects: Different clinical isolates of C. dubliniensis may respond differently to genetic manipulation. Using well-characterized laboratory strains with auxotrophic markers like ura3 facilitates more consistent results .

  • Off-target effects: CRISPR-Cas9 systems, if adapted for C. dubliniensis, require careful sgRNA design to minimize off-target effects, especially given the diploid nature of the genome.

How should researchers optimize heterologous expression of C. dubliniensis AIM14 while maintaining proper folding and activity?

Optimizing heterologous expression requires balancing protein yield with proper folding and activity:

What are the best practices for designing experiments to study metalloreductase function in different host environments?

When studying metalloreductase function across different host environments or infection models:

  • Cell culture models:

    • Macrophage interaction models to assess metalloreductase role in survival within phagocytes

    • Epithelial cell adhesion assays to evaluate contribution to host cell attachment

    • Experimental design should include:

      • Wild-type C. dubliniensis

      • AIM14 deletion mutant

      • Complemented strain (to confirm phenotype specificity)

      • Controls for cell viability and cytotoxicity

  • Biofilm formation assays:

    • Static biofilm models on different substrates (polystyrene, silicone)

    • Flow cell systems to mimic dynamic environments

    • Confocal microscopy with fluorescent reporters to visualize spatial metalloreductase expression

    • Quantification parameters should include:

      • Biomass (crystal violet staining)

      • Metabolic activity (XTT reduction)

      • Matrix composition

      • Gene expression patterns

  • Animal models:

    • Murine models of oral candidiasis

    • Galleria mellonella insect models for higher throughput screening

    • Considerations include:

      • Inoculum preparation standardization

      • Sampling time points

      • Tissue burden quantification

      • Host response assessment

  • Environmental stress responses:

    • Oxidative stress (H2O2, menadione)

    • Metal starvation (iron chelators, calprotectin)

    • pH extremes

    • Antifungal drugs

    • Experimental design should include:

      • Dose-response relationships

      • Time-course analyses

      • Combinatorial stress effects

      • Cross-adaptation phenomena

  • Controls and validation:

    • Include heterologous expression of C. albicans AIM14 ortholog in C. dubliniensis mutants to assess functional conservation

    • Use multiple independent deletion mutants to confirm phenotypes

    • Employ complementary methodologies (e.g., genetics, biochemistry, cell biology) to validate findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.