Recombinant Candida glabrata 3-ketoacyl-CoA reductase (CAGL0H07513g)

Shipped with Ice Packs
In Stock

Description

Introduction

Candida glabrata is an opportunistic fungal pathogen known for causing infections, particularly in immunocompromised individuals . Its resistance to common antifungal drugs poses a significant clinical challenge . The enzyme 3-ketoacyl-CoA reductase (KAR), encoded by the gene CAGL0H07513g in C. glabrata, participates in fatty acid biosynthesis, which is essential for fungal growth and virulence . Inhibiting this enzyme could be a promising strategy for developing new antifungal treatments .

General Information

Recombinant Full Length Candida Glabrata 3-Ketoacyl-Coa Reductase(Cagl0H07513G) Protein, His-Tagged is a protein produced using recombinant DNA technology . It corresponds to the full-length (1-352 amino acids) of the 3-ketoacyl-CoA reductase enzyme from Candida glabrata . This protein is expressed in E. coli and has an N-terminal His tag for purification purposes .

Synonyms: CAGL0H07513g; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase

UniProt ID: Q6FRM0

Source: E. coli

Tag: His

Protein Length: Full Length (1-352)

AA Sequence: MTFVRELEVASQNSRAFNVTLWFIFIFGLLKLVPFALRFLSMVFDLFVLPPVNYAKYGCKAGDYAVVTGASDGIGKEFASQLASKGFNLVLISRTESKLVALKDELEGKFNIKAKILAIDISADSKDNYNKIYSLCDDLPISILVNNVGQSHSIPVPFLATEEEEMRNIITINNTATLMITQIIAPIIIRTVKKHRESGDKKLKSQRGLILTMGSFGGLIPTPLLATYSGSKAFLQNWSSSLAGELAADNVDVELVLSYLVTSAMSKVRRTSMMIPNPRTFVKSTLRNIGRRCGAQDRYGTITPFWSHAIYHFVIEELFGVYARVVNEINYKFHKSIRIRAVRKAVREAKQN

Function and Importance

3-ketoacyl-CoA reductase (KAR) is an enzyme involved in the fatty acid biosynthesis pathway . Fatty acid synthesis is crucial for the survival and virulence of fungal pathogens . The enzyme catalyzes a reduction reaction in the elongation cycle of fatty acid synthesis .

Expression and Purification

Recombinant CAGL0H07513g is typically produced in E. coli and purified using its His-tag .

  • The protein is expressed as a fusion protein with a polyhistidine tag (His-tag) at the N-terminus .

  • This tag allows for purification using affinity chromatography, where the protein binds to a nickel column and is then eluted .

Biochemical Properties

While the exact biochemical properties of recombinant CAGL0H07513g may vary depending on the expression and purification conditions, some general properties can be expected:

PropertyDescription
Molecular WeightThe molecular weight can be calculated based on the amino acid sequence (352 aa) plus the His-tag.
PurityGreater than 90% as determined by SDS-PAGE .
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

Role in Antifungal Resistance

C. glabrata's increasing resistance to antifungals makes it crucial to explore alternative drug targets and therapeutic strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
CAGL0H07513g; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
CAGL0H07513g
Target Protein Sequence
MTFVRELEVASQNSRAFNVTLWFIFIFGLLKLVPFALRFLSMVFDLFVLPPVNYAKYGCK AGDYAVVTGASDGIGKEFASQLASKGFNLVLISRTESKLVALKDELEGKFNIKAKILAID ISADSKDNYNKIYSLCDDLPISILVNNVGQSHSIPVPFLATEEEEMRNIITINNTATLMI TQIIAPIIIRTVKKHRESGDKKLKSQRGLILTMGSFGGLIPTPLLATYSGSKAFLQNWSS SLAGELAADNVDVELVLSYLVTSAMSKVRRTSMMIPNPRTFVKSTLRNIGRRCGAQDRYG TITPFWSHAIYHFVIEELFGVYARVVNEINYKFHKSIRIRAVRKAVREAKQN
Uniprot No.

Target Background

Function

Recombinant Candida glabrata 3-ketoacyl-CoA reductase (CAGL0H07513g) is a microsomal membrane-bound enzyme integral to the fatty acid elongation system. It is involved in the production of 26-carbon very long-chain fatty acids (VLCFAs) from palmitate by catalyzing the reduction of the 3-ketoacyl-CoA intermediate in each elongation cycle. VLCFAs serve as precursors for ceramide and sphingolipids.

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the role of reductase enzymes in Candida glabrata metabolism?

Reductase enzymes in C. glabrata play crucial roles in various metabolic pathways. The 3-hydroxy-3-methyl-glutaryl CoA reductase (HMGR), for example, is a glycoprotein of the endoplasmic reticulum that participates in the mevalonate pathway, which is the precursor of ergosterol in fungi (analogous to cholesterol in humans) . The ergosterol biosynthesis pathway is essential for fungal cell membrane integrity and function. Additionally, certain reductases in the aldo-keto-reductase superfamily have been found to be upregulated in antifungal-resistant C. glabrata clinical isolates, suggesting their importance in stress responses and drug resistance mechanisms .

Methodologically, when investigating these enzymes, researchers should consider their subcellular localization, enzymatic activity under varying conditions, and their regulation in response to environmental stressors such as oxidative stress or antifungal exposure.

What is the structural organization of HMGR in Candida glabrata?

The HMGR enzyme in C. glabrata consists of three distinct domains: transmembrane, binding, and soluble domains . The transmembrane domain anchors the protein to the endoplasmic reticulum membrane, while the binding domain is involved in substrate recognition. The soluble domain contains the catalytic site responsible for the enzymatic activity.

For experimental approaches, researchers often focus on the soluble fraction of the enzyme for recombinant expression and characterization studies, as it contains the catalytic domain and is more amenable to purification and analysis compared to the full-length membrane-bound protein .

How do I determine the optimal conditions for recombinant C. glabrata reductase activity?

To determine optimal conditions for enzyme activity, a systematic characterization approach is necessary:

  • pH optimization: Test enzyme activity across a range of pH values (typically pH 5-9) using appropriate buffer systems

  • Temperature profiling: Evaluate activity at temperatures ranging from 25-45°C

  • Cofactor requirements: Assess dependence on NADPH or NADH

  • Salt concentration effects: Test various ionic strengths

For example, the recombinant soluble fraction of C. glabrata HMGR (CgHMGR) exhibits optimal activity at pH 8.0 and 37°C . The kinetic parameters for this enzyme with HMG-CoA as substrate were determined to be Km = 6.5 μM and Vmax = 2.26 × 10-3 μM min-1, providing baseline values for comparison with mutant variants or under different conditions .

What expression systems are most effective for recombinant C. glabrata reductases?

Escherichia coli remains the most commonly used heterologous expression system for C. glabrata reductases due to its simplicity, cost-effectiveness, and high protein yield. When expressing recombinant CgHMGR, researchers have successfully used E. coli systems with fusion tags to enhance solubility and facilitate purification .

For optimal expression:

  • Select an appropriate E. coli strain (BL21(DE3), Rosetta, etc.) based on codon usage

  • Consider fusion partners to improve solubility (MBP, GST, SUMO)

  • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Screen multiple constructs varying the N- and C-terminal boundaries

In one successful approach, the soluble fraction of CgHMGR was fused to maltose binding protein (MBP), which improved solubility and facilitated purification through affinity chromatography .

What purification strategy yields the highest purity and activity for recombinant C. glabrata enzymes?

A multi-step purification strategy is recommended to achieve high purity while maintaining enzymatic activity:

  • Initial capture: Affinity chromatography using the fusion tag (e.g., MBP, His-tag)

  • Intermediate purification: Ion exchange chromatography to separate charge variants

  • Polishing: Size exclusion chromatography to remove aggregates and achieve final purity

For CgHMGR, fusion with MBP has proven effective for initial purification, allowing for a streamlined process that maintains enzyme activity . After purification, it's crucial to verify enzyme purity through SDS-PAGE and assess activity using established enzymatic assays specific to the reductase being studied.

When designing a purification protocol, consider including protease inhibitors to prevent degradation, and optimize buffer conditions (pH, salt concentration, glycerol content) to maintain protein stability throughout the purification process.

How can I assess the kinetic parameters of purified recombinant reductases?

Kinetic characterization should follow a systematic approach:

  • Initial rate determination: Measure enzyme activity at varying substrate concentrations under standard conditions

  • Data analysis: Use appropriate models (Michaelis-Menten, Lineweaver-Burk) to calculate kinetic parameters

  • Cofactor analysis: Determine the preference and kinetics for NADPH versus NADH

  • Inhibition studies: Evaluate the effect of potential inhibitors using IC50 determinations

For example, in studies with recombinant CgHMGR, researchers determined Km and Vmax values for HMG-CoA and demonstrated inhibition by simvastatin with an IC50 of 14.5 μM . This provides a quantitative basis for comparing wild-type and mutant enzymes or evaluating potential inhibitors.

ParameterValue for CgHMGRMethod of Determination
Optimal pH8.0pH activity profile
Optimal temperature37°CTemperature activity profile
Km for HMG-CoA6.5 μMMichaelis-Menten kinetics
Vmax2.26 × 10-3 μM min-1Michaelis-Menten kinetics
IC50 for simvastatin14.5 μMInhibition studies

How should I design point mutation experiments to study the function of conserved residues in C. glabrata reductases?

When designing point mutation experiments, follow these methodological steps:

  • Sequence alignment: Perform multiple sequence alignments with homologous enzymes to identify conserved residues

  • Structural analysis: Use available crystal structures or homology models to understand the spatial context of target residues

  • Rational mutation selection: Choose mutations that probe specific hypotheses about catalysis, substrate binding, or structural integrity

  • Site-directed mutagenesis: Use established protocols to generate point mutations in your expression construct

For C. glabrata HMGR, researchers have successfully targeted highly conserved regions of the catalytic domain to explore the function of key amino acid residues . Specific examples include substituting glutamic acid with glutamine at positions E680Q (dimerization site) and E711Q (substrate binding site), aspartic acid with alanine at D805A (cofactor binding site), and methionine with arginine at M807R (cofactor binding site) .

What controls should be included when characterizing enzyme variants with point mutations?

Proper experimental controls are essential for meaningful interpretation of mutation studies:

  • Wild-type control: Always include the wild-type enzyme processed identically to mutants

  • Expression level verification: Confirm similar expression levels between wild-type and mutants

  • Protein folding assessment: Use circular dichroism or thermal shift assays to verify proper folding

  • Multiple substrate/cofactor concentrations: Test across concentration ranges to detect subtle kinetic effects

In studies of C. glabrata HMGR mutations, researchers compared the enzymatic activity of mutants to the wild-type enzyme under identical conditions . They also performed in silico binding energy calculations for substrates and inhibitors to correlate with in vitro findings, providing a more comprehensive understanding of the effects of specific mutations .

How do mutations in specific domains affect enzyme-inhibitor interactions for C. glabrata reductases?

The relationship between mutations and inhibitor efficacy can be investigated using a combination of approaches:

  • Enzyme inhibition assays: Determine IC50 values for inhibitors against wild-type and mutant enzymes

  • Binding energy calculations: Use computational approaches to predict changes in inhibitor binding

  • Structural analysis: If possible, obtain crystal structures of enzyme-inhibitor complexes

  • Thermal shift assays: Measure changes in protein stability in the presence of inhibitors

Research on C. glabrata HMGR has shown that mutations in the catalytic domain can significantly affect the binding energy of inhibitors like simvastatin . For example, the E711Q mutation in the substrate binding site displayed the lowest enzymatic activity and binding energy, highlighting the importance of this residue . These findings demonstrate how point mutations can provide valuable insights into the molecular basis of enzyme-inhibitor interactions.

How can transcriptomic analysis be used to understand the regulation of reductase genes in C. glabrata under different stress conditions?

Transcriptomic analysis provides critical insights into gene regulation:

  • Experimental design: Expose C. glabrata to relevant stressors (oxidative stress, antifungal agents, nutrient limitation)

  • RNA extraction: Use established protocols for high-quality RNA isolation

  • Expression analysis: Employ RT-PCR or RNA-seq to quantify changes in transcript levels

  • Data validation: Confirm key findings using independent methods (qPCR, protein levels)

Studies with C. glabrata have revealed significant transcriptional responses to stress conditions. For example, research on CgDTR1 (though not a reductase) demonstrated that transcript levels were up-regulated 100-fold after 24-48 hours of internalization in Galleria mellonella hemocytes, suggesting its importance in adaptation to growth inside macrophages .

Furthermore, when C. glabrata cells were exposed to oxidative stress (20 mM hydrogen peroxide), significant upregulation of gene expression was observed, while exposure to acetic acid actually led to downregulation . These findings highlight the importance of testing multiple stress conditions when studying gene regulation in C. glabrata.

ConditionCgDTR1 Expression (fold change)Time Point
Non-internalized cells4-fold up-regulation1 hour
Internalized in hemocytes100-fold up-regulation24-48 hours
20 mM H₂O₂ exposureSignificant up-regulation1 hour
Acetic acid exposureDown-regulation1 hour

What approaches can be used to correlate reductase activity with antifungal resistance in C. glabrata?

To investigate the relationship between reductase activity and antifungal resistance:

  • Clinical isolate comparison: Compare enzyme activity in susceptible versus resistant isolates

  • Gene expression analysis: Quantify reductase transcript levels in response to antifungal exposure

  • Gene knockdown/knockout studies: Use genetic approaches to modulate reductase expression

  • Phenotypic analysis: Measure growth inhibition, biofilm formation, and virulence

Research has shown that C. glabrata clinical isolates have the aldo-keto-reductase superfamily upregulated in resistant strains, suggesting a potential role in antifungal resistance mechanisms . By correlating enzyme activity levels with minimum inhibitory concentrations (MICs) of antifungals, researchers can gain insights into the contribution of specific reductases to resistance phenotypes.

How can I address low expression or insolubility of recombinant C. glabrata reductases?

Low expression or insolubility issues can be addressed through several approaches:

  • Expression optimization:

    • Test multiple E. coli strains (BL21, Rosetta, Arctic Express)

    • Vary induction conditions (temperature, IPTG concentration, duration)

    • Use auto-induction media to achieve gradual protein expression

  • Solubility enhancement:

    • Employ solubility-enhancing fusion tags (MBP, SUMO, GST)

    • Add solubilizing agents to lysis buffer (mild detergents, arginine)

    • Consider co-expression with chaperones

  • Construct optimization:

    • Design multiple constructs with varying domain boundaries

    • Remove hydrophobic regions or unstructured elements

    • Consider synthetic genes with codon optimization

For CgHMGR, researchers successfully used the maltose binding protein (MBP) fusion approach to enhance solubility of the catalytic domain . This strategy not only improved solubility but also facilitated purification through affinity chromatography.

What are the common pitfalls in kinetic characterization of fungal reductases?

Several challenges can arise during kinetic characterization:

  • Substrate limitations:

    • Limited solubility of lipophilic substrates

    • Substrate degradation during assay

    • Interference from substrate analogues or impurities

  • Assay considerations:

    • Ensuring linear reaction rates and appropriate enzyme concentrations

    • Accounting for background reactions or spontaneous substrate conversion

    • Controlling for cofactor quality and concentration

  • Data analysis issues:

    • Non-Michaelis-Menten behavior (substrate inhibition, cooperativity)

    • Proper statistical analysis and curve fitting

    • Accounting for enzyme stability during assay

When characterizing CgHMGR, researchers carefully optimized assay conditions to determine accurate kinetic parameters (Km = 6.5 μM and Vmax = 2.26 × 10-3 μM min-1 for HMG-CoA) . These parameters provided a foundation for comparing the enzyme with variants and evaluating potential inhibitors.

How can I validate that my recombinant C. glabrata reductase maintains native structure and function?

Validation of native structure and function requires multiple approaches:

  • Structural characterization:

    • Circular dichroism to assess secondary structure

    • Thermal shift assays to evaluate stability

    • Limited proteolysis to probe folding integrity

  • Functional validation:

    • Compare kinetic parameters with reported values for similar enzymes

    • Verify expected substrate specificity and cofactor preferences

    • Confirm sensitivity to known inhibitors

  • Complementation studies:

    • Test if the recombinant enzyme can restore function in deficient yeast strains

    • Evaluate phenotypic rescue in relevant model systems

For C. glabrata HMGR, researchers validated their recombinant enzyme by demonstrating proper enzymatic activity, determining kinetic parameters, and confirming inhibition by simvastatin with an IC50 of 14.5 μM . Such comprehensive characterization helps ensure that the recombinant enzyme faithfully represents the native enzyme's properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.