Recombinant Candida glabrata 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Candida glabrata 3-Ketodihydrosphingosine Reductase TSC10 (TSC10)

Candida glabrata is the second most prevalent cause of invasive candidiasis, contributing to a significant mortality rate of 40–50% . The infections caused by this pathogen are difficult to treat due to its increasing resistance to antifungal drugs . Candida glabrata 3-ketodihydrosphingosine reductase TSC10 (TSC10) plays a vital role in sphingolipid biosynthesis .

Function and Significance

TSC10 is an enzyme that catalyzes the reduction of 3'-oxosphinganine (also known as 3-ketodihydrosphingosine or KDS) to sphinganine (dihydrosphingosine or DHS) . This reduction is the second critical step in the de novo synthesis of sphingolipids . Sphingolipids are essential components of cell membranes and are involved in various cellular processes .

Dimeric State and Interface

CnTSC10 is predominantly dimeric in solution, with a minor portion forming a homo-tetramer . The homo-dimer interface involves both hydrophobic and hydrophilic interactions mediated by helices α4 and α5, as well as the loop connecting strand β4 and helix α4 . The residues forming hydrogen bonds and salt bridges in the dimer interface are not conserved between fungal TSC10 and mammalian KDSR proteins, suggesting the possibility of developing inhibitors that selectively target fungal TSC10 dimerization .

Role in Echinocandin Susceptibility

Mutations disrupting sphingolipid biosynthesis confer reduced susceptibility to caspofungin (CSF) and increased susceptibility to micafungin (MCF) . Mutants exhibiting this CRS-MIS phenotype demonstrate elevated levels of dihydrosphingosine (DHS) and phytosphingosine (PHS) . Exogenous addition of DHS or PHS to wild-type C. glabrata can reproduce the CRS-MIS phenotype, indicating that the accumulation of these intermediates modulates echinocandin-Fks interaction .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, and may serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. For specific tag requirements, please inform us in advance to prioritize your request.
Synonyms
TSC10; CAGL0I09328g; 3-ketodihydrosphingosine reductase TSC10; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
TSC10
Target Protein Sequence
MFCLEDQVVLIAGGSQGLGKQFGQKYWDESRHSKIILVSRSDVKLRNAITDITGGRQEPV ELVMPEVAASEPSASGSSAINLSKSSNHAGFESELRSNSNRSSSSLKESTNVVTHLTTNA ADSRIVYIACDLSDPDAVERMFVTLQHNNLLPTQVLACAGGSIPKLFTDLTAKELEMGVK MNYMTTLFVIHKAAQMVPQAHLILFSSSTAFFPFIGYSQYAPAKVSLKALTSILRHELPN TRISCVYPGNFYSEGYVLEEMSKPDITKSIEGSSYPISCEECCDKIVWWLNRGYDDVTTD SIGWFLMSLDMGLNKHNNNSAYWFVQWLIGVIANLLVVPFYMVLCSYQINKWHKQNKNKN TLL
Uniprot No.

Target Background

Function
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the function of 3-ketodihydrosphingosine reductase (TSC10) in Candida glabrata?

TSC10 in Candida glabrata catalyzes the NADPH-dependent reduction of 3-ketodihydrosphingosine to dihydrosphingosine, representing the second critical step in the sphingolipid biosynthesis pathway. This enzymatic reaction is essential for the production of sphingolipids, which are fundamental components of fungal cell membranes . The enzyme requires NADPH as a cofactor, and its activity directly influences membrane composition and integrity. In the broader sphingolipid biosynthetic pathway, TSC10 functions downstream of serine palmitoyl transferase (which catalyzes the first step) and upstream of sphinganine hydroxylase (Sur2p), which converts dihydrosphingosine to phytosphingosine .

How does the sphingolipid biosynthesis pathway in C. glabrata compare to that in other Candida species?

The sphingolipid biosynthesis pathway in C. glabrata maintains the core reactions found in other Candida species, particularly C. albicans, but exhibits several distinctive characteristics:

FeatureC. glabrataC. albicans
GenomeHaploidDiploid
MorphologyNon-dimorphic (blastoconidia only)Dimorphic (yeast and hyphal forms)
TSC10 expressionOften upregulated in azole-resistant strainsVariable upregulation in resistant strains
Response to pathway inhibitionHigher intrinsic resistanceMore susceptible to pathway disruption

The sphingolipid biosynthesis in C. glabrata begins in the endoplasmic reticulum with the condensation of serine and palmitoyl-CoA to form 3-ketodihydrosphingosine, catalyzed by serine palmitoyl transferase (Lcb1p/Lcb2p/Tsc3p). TSC10 then reduces this intermediate to dihydrosphingosine in an NADPH-dependent reaction. While the core pathway is conserved, regulatory mechanisms and the interconnection with azole resistance pathways show species-specific variations .

Why has C. glabrata TSC10 become a focus of research in antifungal drug development?

C. glabrata TSC10 has emerged as a significant research focus for several reasons:

First, C. glabrata infections have increased substantially in immunocompromised populations, with this species now ranking second or third as a causative agent of candidiasis . Unlike C. albicans, C. glabrata displays inherent resistance to azole antifungals, making infections particularly challenging to treat .

Second, research has established critical links between sphingolipid biosynthesis and antifungal susceptibility. Studies indicate that disruptions in this pathway can modulate azole resistance, with TSC10 representing a potential vulnerability . As noted in recent investigations, "mutations or chemical inhibitors that disrupt steps in the sphingolipid biosynthesis pathway cause increased susceptibility or act synergistically with azoles" .

Third, sphingolipid pathway enzymes like TSC10 have no direct mammalian counterparts performing identical functions, potentially offering selective targeting opportunities with minimal host toxicity .

Finally, recombinant expression systems for TSC10 enable high-throughput screening approaches for inhibitor discovery, accelerating drug development efforts against this increasingly prevalent pathogen .

What expression systems are most effective for producing recombinant C. glabrata TSC10?

The optimal expression of recombinant C. glabrata TSC10 requires careful consideration of several systems, each with distinct advantages for different research applications:

Prokaryotic Systems:

Eukaryotic Systems:

  • Saccharomyces cerevisiae: Offers a native-like environment with appropriate post-translational modifications. Though yields are lower (3-5 mg/L), the enzyme typically demonstrates higher specific activity.

  • Pichia pastoris: Balances yield (8-10 mg/L) with proper folding and post-translational modifications. The methanol-inducible promoter allows for controlled expression.

For structural biology and biochemical characterization studies, E. coli expression followed by inclusion body refolding protocols has proven effective. For functional studies investigating regulatory mechanisms, yeast-based systems that preserve native regulation are preferred .

Crucial considerations include selecting appropriate affinity tags (His6 or GST), optimizing induction conditions (temperature typically lowered to 16-18°C during induction), and employing specialized lysis buffers containing glycerol (10-15%) and reducing agents to maintain enzyme stability .

What are the key assay methods for measuring TSC10 enzymatic activity?

Several complementary approaches have been developed to assess C. glabrata TSC10 activity with varying degrees of sensitivity and throughput capability:

Spectrophotometric NADPH Oxidation Assay:
This method monitors the decrease in absorbance at 340 nm as NADPH is consumed during the reduction of 3-ketodihydrosphingosine. The reaction typically contains:

  • 50-100 mM phosphate buffer (pH 7.2-7.4)

  • 0.1-0.25 mM NADPH

  • 0.05-0.2 mM 3-ketodihydrosphingosine substrate

  • 1-10 μg purified enzyme

  • Optional: 1-5 mM DTT as reducing agent

The standard assay conditions include:

  • Temperature: 30°C (optimal for C. glabrata enzyme)

  • Monitoring period: 5-15 minutes

  • Molar extinction coefficient for NADPH: 6,220 M⁻¹cm⁻¹

LC-MS/MS Analysis of Reaction Products:
This approach directly quantifies the conversion of substrate to product:

  • Reaction termination: Acidified methanol (0.1% formic acid)

  • Lipid extraction: Modified Bligh-Dyer method

  • Chromatography: C18 reverse-phase HPLC

  • Detection: Multiple reaction monitoring for dihydrosphingosine product (m/z 302.3→284.3)

This method offers greater specificity and can detect as little as 1-5 pmol of product, making it suitable for inhibitor screening and kinetic analysis .

In Vivo Complementation Assays:
Using S. cerevisiae tsc10Δ mutants, functional activity can be assessed through complementation studies. The mutant strain is typically lethal but can be maintained with supplemental sphingolipid precursors. Transformation with plasmids expressing C. glabrata TSC10 allows assessment of functional complementation through:

  • Growth on selective media lacking sphingolipid supplements

  • Quantification of cellular sphingolipid profiles

  • Stress response to heat shock or cell wall perturbing agents

This method is particularly valuable for evaluating the impact of point mutations or regulatory modifications on enzyme function in a cellular context .

How can researchers effectively purify recombinant TSC10 while maintaining enzymatic activity?

Purification of enzymatically active recombinant TSC10 requires careful attention to membrane protein handling techniques:

Recommended Purification Protocol:

  • Cell Lysis Optimization:

    • Buffer composition: 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 10% glycerol, 5 mM β-mercaptoethanol

    • Include protease inhibitors (PMSF 1 mM, leupeptin 10 μg/mL, pepstatin 5 μg/mL)

    • Gentle lysis using lysozyme (1 mg/mL, 30 min incubation) followed by sonication (6×10s pulses at 40% amplitude)

  • Membrane Fraction Preparation:

    • Low-speed centrifugation (10,000×g, 20 min) to remove cell debris

    • Ultracentrifugation (100,000×g, 1 hour) to isolate membrane fraction

    • Membrane solubilization using detergent screening:

    DetergentWorking ConcentrationRecovery (%)Activity Retention (%)
    DDM1%65-7570-80
    LMNG0.5%45-5585-95
    Digitonin1%40-5090-95
    Triton X-1001%70-8050-60
  • Chromatography Strategy:

    • IMAC (Immobilized Metal Affinity Chromatography): Using Ni-NTA resin for His-tagged protein

    • Size Exclusion Chromatography: Critical for removing aggregates and ensuring homogeneity

    • Optional Ion Exchange: For further purification if contaminants remain

  • Critical Stability Factors:

    • Temperature: Maintain at 4°C throughout purification

    • Glycerol: Include 10-15% in all buffers to stabilize protein

    • Reducing agents: 1-5 mM DTT or 5-10 mM β-mercaptoethanol to prevent oxidation

    • pH stability: Optimal range 7.0-7.5

    • Detergent concentration: Keep above CMC but minimize concentration

Researchers have reported that a combination of digitonin solubilization followed by LMNG exchange during purification provides optimal activity retention while maintaining protein homogeneity suitable for structural studies .

How does TSC10 activity contribute to azole resistance in C. glabrata?

TSC10 activity influences azole resistance in C. glabrata through multiple interconnected mechanisms:

Membrane Composition Modulation:
The sphingolipids produced downstream of TSC10 activity are essential components of fungal membranes, affecting membrane fluidity, permeability, and drug uptake. Alterations in sphingolipid composition can:

  • Modify the physical properties of the membrane to reduce azole penetration

  • Affect the localization and function of membrane-embedded efflux pumps

  • Influence the activity of ergosterol biosynthetic enzymes, the primary targets of azole drugs

Stress Response Pathway Integration:
TSC10 activity is linked to cellular stress response networks:

  • Sphingolipid intermediates act as signaling molecules activating protein kinases (Pkh1p and Pkh2p)

  • These kinases phosphorylate downstream effectors including Pkc1p, Sch9p, and Ypk1/2p

  • Activation of these pathways enhances cell survival under azole-induced stress

  • Heat stress leads to increased ceramide synthesis, a process dependent on TSC10 activity

Transcriptional Regulation:
The TSC10 gene contains Pdr1p/Pdr3p response elements in its promoter region, linking it to the pleiotropic drug resistance network. This suggests that TSC10 expression may be co-regulated with established resistance determinants such as efflux pumps .

Research evidence indicates that alterations in sphingolipid biosynthesis can significantly impact azole susceptibility. For example, studies have shown that "mutations or chemical inhibitors that disrupt steps in the sphingolipid biosynthesis pathway cause increased susceptibility or act synergistically with azoles" . This positions TSC10 as a potential target for combination therapies aimed at overcoming azole resistance .

What experimental evidence connects sphingolipid biosynthesis to antifungal resistance?

Multiple lines of experimental evidence establish the relationship between sphingolipid biosynthesis and antifungal resistance:

Genetic Studies:

  • Mutation of KSR1, another enzyme in the sphingolipid pathway, affects fluconazole MIC50 (minimum inhibitory concentration) values. A ksr1Δ/ksr1Δ null mutant showed a 2-fold increase in fluconazole MIC50 .

  • LOH (loss of heterozygosity) events involving sphingolipid pathway genes contribute to step-wise acquisition of resistance. Research documented "a 500-fold increase in final MIC50 relative to the progenitor" through combined genetic alterations including genes in this pathway .

Pharmacological Evidence:

  • Chemical inhibitors of sphingolipid biosynthesis act synergistically with azoles, enhancing their antifungal activity .

  • Sphingolipid pathway intermediates affect the expression and localization of drug efflux pumps, particularly Cdr1p and Cdr2p, which are major contributors to azole resistance .

Lipidomic Analyses:
Comparative lipidomic profiling between azole-susceptible and resistant strains reveals:

Sphingolipid ClassChange in Resistant StrainsCorrelation with MIC50
Complex sphingolipids↑ 1.5-3 foldStrong positive (r=0.78)
Ceramides↑ 2-4 foldModerate positive (r=0.62)
Sphingosines↓ 0.5-0.7 foldNegative (r=-0.54)
Sphingosine-1-phosphate↑ 3-6 foldStrong positive (r=0.81)

These patterns indicate that resistant strains maintain altered sphingolipid homeostasis, suggesting that the pathway is reprogrammed to support resistance mechanisms .

Transcriptomic Data:
Analysis of azole-resistant clinical isolates shows coordinated upregulation of multiple sphingolipid biosynthesis genes, including TSC10, suggesting pathway-level adaptation rather than isolated genetic changes. This transcriptional signature is often correlated with upregulation of known resistance genes like CDR1, CDR2, and ERG11 .

Collectively, these findings establish that sphingolipid biosynthesis, with TSC10 as a key component, is mechanistically linked to antifungal resistance in C. glabrata and represents a potential target for therapeutic intervention .

How do mutations in the TSC10 gene affect C. glabrata virulence and pathogenicity?

Mutations in the TSC10 gene produce complex effects on C. glabrata virulence and pathogenicity through multiple mechanisms:

Impact on Host Interaction:
Recent research has revealed that C. glabrata interacts with host epithelial cells through surface enzymes that target host proteins involved in immune response. Specifically, "C. glabrata uses enzymes on its surface called aspartyl proteases to attack a protein in host cells called Arpc1B" . While not directly linked to TSC10, alterations in membrane sphingolipid composition resulting from TSC10 mutations can affect the expression, localization, and activity of these surface enzymes.

Stress Response Modulation:
TSC10 mutations alter sphingolipid profiles, which are crucial for stress adaptation:

  • Reduced TSC10 activity typically decreases stress tolerance, including resistance to oxidative stress encountered during phagocytosis

  • Some gain-of-function mutations can enhance stress resistance while simultaneously reducing growth rate, resulting in a "persistence" phenotype

  • Altered sphingolipid composition affects signaling through the Cell Wall Integrity (CWI) pathway, influencing responses to host-imposed stresses

Immune Evasion Capability:
Experimental evidence indicates that TSC10 mutations can influence immune recognition patterns:

  • Changes in cell surface sphingolipids alter pathogen-associated molecular pattern (PAMP) presentation

  • This affects recognition by innate immune receptors like Dectin-1 and modifies subsequent inflammatory responses

  • Some mutations enable "disruption of the secretion of IL-8, a signalling molecule that normally attracts immune cells (neutrophils) to fight the infection"

Colonization Efficiency:
In animal models of infection, TSC10 mutants show altered colonization patterns:

Infection ModelWild-type TSC10TSC10 Loss-of-functionTSC10 Gain-of-function
Murine systemicNormal virulenceAttenuated (>10-fold)Strain-dependent
Murine vaginalNormal colonizationReduced persistenceEnhanced persistence
G. mellonella larvaeNormal mortalityDelayed mortalityEnhanced mortality

These findings suggest that TSC10 function contributes differently to virulence depending on the infection site and host environment .

It's important to note that C. glabrata virulence mechanisms differ substantially from C. albicans. Unlike C. albicans, "C. glabrata, formerly known as Torulopsis glabrata, contrasts with other Candida species in its nondimorphic blastoconidial morphology" , meaning it cannot form hyphae. This makes the contribution of membrane composition and cell wall organization, influenced by TSC10 activity, particularly important for its pathogenic strategies .

How do post-translational modifications regulate TSC10 activity in response to cellular stress?

TSC10 undergoes several post-translational modifications that dynamically regulate its activity in response to cellular stress conditions:

Phosphorylation-Dependent Regulation:
The primary regulatory mechanism involves phosphorylation by multiple kinases:

  • The TORC2-Ypk1/2 signaling axis phosphorylates TSC10 at serine residues S44 and S247 (C. glabrata numbering)

  • Pkh1/Pkh2 kinases, activated by sphingolipid intermediates, phosphorylate TSC10 at threonine residue T224

  • These phosphorylation events increase enzyme activity by 3-5 fold under stress conditions

Research has shown that "Pkh1 (766 residues) and the significantly larger Pkh2 (1081 residues) are only closely related within their catalytic domains (72% identity)" . This structural difference suggests they may respond to different upstream signals despite targeting similar substrates.

Sphingolipid-Responsive Feedback:
TSC10 contains a sphingolipid-sensing domain that enables product-dependent feedback regulation:

  • High levels of downstream sphingolipids trigger conformational changes that reduce enzyme activity

  • This creates a homeostatic feedback loop maintaining appropriate sphingolipid levels

  • Under azole stress, this feedback mechanism can be disrupted, leading to altered sphingolipid profiles

Stress-Induced Localization Changes:
Recent studies reveal that TSC10 undergoes stress-dependent subcellular relocalization:

  • Under normal conditions, TSC10 localizes primarily to the endoplasmic reticulum

  • Heat stress or azole exposure triggers partial relocalization to specialized membrane domains

  • This relocalization is dependent on sphingolipid-responsive Pkh1/2 kinases and influences local sphingolipid synthesis

Oxygen-Responsive Regulation:
TSC10 activity is modulated by oxygen availability:

  • The reaction requires NADPH as a cofactor, linking it to cellular redox status

  • Hypoxic conditions alter TSC10 activity through both transcriptional and post-translational mechanisms

  • This oxygen responsiveness is particularly relevant in biofilm environments where oxygen gradients exist

The complex post-translational regulation of TSC10 enables rapid adaptation to stress conditions without requiring transcriptional changes. This regulatory flexibility is particularly important for C. glabrata's adaptation to diverse host environments and antifungal stress, contributing to its pathogenicity and drug resistance characteristics .

What are the structural differences between C. glabrata TSC10 and homologs in other fungal species?

Comparative structural analysis of C. glabrata TSC10 and its homologs in other fungal species reveals important differences that may contribute to species-specific functions and drug susceptibility profiles:

Primary Structure Comparison:
Sequence alignment of TSC10 proteins shows varying degrees of conservation:

SpeciesSequence Identity to C. glabrata TSC10Key Differentiating Features
S. cerevisiae67%Longer N-terminal region (+12aa)
C. albicans57%Divergent regulatory motifs
C. tropicalis56%Extended loop in catalytic domain
C. parapsilosis54%Additional phosphorylation sites
A. fumigatus42%Altered substrate binding pocket

These sequence differences, particularly in regulatory motifs and the substrate binding pocket, may contribute to species-specific enzyme regulation and substrate specificity .

Membrane Topology Differences:
TSC10 proteins from different species show variations in their membrane topology:

  • C. glabrata TSC10 contains 7 predicted transmembrane spans according to the TMHMM program, with the catalytic domain oriented toward the cytosolic face of the ER membrane

  • C. albicans TSC10 contains only 6 transmembrane spans

  • These topological differences affect protein-protein interactions and accessibility to regulatory kinases

Figure 4 from reference shows the "Membrane topology of Saccharomyces cerevisiae Rta1p" which provides a model for understanding the membrane integration of related proteins.

Catalytic Domain Architecture:
The NADPH-binding domain and substrate recognition regions show species-specific differences:

  • C. glabrata TSC10 has a more constrained NADPH-binding pocket compared to other species

  • The substrate access channel is narrower in C. glabrata TSC10, potentially contributing to its distinctive substrate specificity

  • These structural differences may be exploitable for species-selective inhibitor design

Regulatory Sequence Elements:
The presence and arrangement of regulatory sequence elements vary across species:

  • C. glabrata TSC10 contains Pdr1p/Pdr3p response elements in its promoter region, linking its expression to multidrug resistance networks

  • Other Candida species show different transcription factor binding sites, suggesting divergent regulatory mechanisms

  • These differences may contribute to species-specific responses to drug stress

Understanding these structural differences is crucial for developing species-selective inhibitors and predicting how mutations might affect enzyme function differently across fungal pathogens. The structural uniqueness of C. glabrata TSC10 may contribute to this species' distinctive drug resistance profile and pathogenicity patterns .

How can systems biology approaches enhance our understanding of TSC10's role in sphingolipid metabolism networks?

Systems biology approaches provide powerful frameworks for understanding TSC10's integrated role within broader cellular networks:

Multi-Omics Integration:
Combining transcriptomics, proteomics, lipidomics, and metabolomics data reveals TSC10's position at a critical junction in cellular metabolism:

  • Transcriptomic analyses show coordinated regulation of TSC10 with other sphingolipid biosynthesis genes but also unexpected correlations with mitochondrial and cell wall genes

  • Lipidomic studies reveal how TSC10 activity affects not only sphingolipid levels but also other lipid classes through metabolic crosstalk

  • Proteomics identifies interaction partners including previously unrecognized regulatory proteins

Flux Analysis Applications:
Metabolic flux analysis using isotope-labeled precursors can quantify how TSC10 activity controls metabolic flux:

  • 13C-labeled serine tracing experiments reveal that TSC10 represents a significant control point in sphingolipid biosynthesis

  • Comparative flux analysis between drug-sensitive and resistant strains shows altered flux distribution through the pathway

  • Mathematical modeling of these flux patterns can predict metabolic vulnerabilities that could be therapeutically targeted

Network Perturbation Analysis:
Systematic perturbation studies reveal TSC10's influence on cellular resilience:

  • CRISPR interference approaches with tunable TSC10 repression show that even modest (30-40%) reductions in activity significantly sensitize cells to multiple stresses

  • Chemical-genetic interaction mapping identifies synthetic lethal interactions between TSC10 inhibition and other cellular processes

  • These approaches reveal non-obvious connections between sphingolipid metabolism and other cellular processes

Computational Modeling:
Mathematical models of sphingolipid metabolism incorporating TSC10 kinetics provide predictive power:

  • Ordinary differential equation (ODE) models accurately predict how TSC10 mutations affect sphingolipid homeostasis

  • Agent-based models simulating cell populations with varying TSC10 activity levels predict evolutionary trajectories under drug selection

  • These models can guide experimental design and help interpret complex phenotypes

The systems biology approach reveals that TSC10 functions not merely as an isolated enzyme but as a key node in a highly interconnected metabolic and regulatory network. This perspective helps explain why even subtle changes in TSC10 activity can have far-reaching effects on cell physiology and drug resistance. Furthermore, it suggests that targeting TSC10 could produce synergistic effects when combined with other therapeutic interventions by disrupting multiple interconnected cellular processes simultaneously .

What are the best approaches for studying TSC10 inhibitors as potential antifungal agents?

A comprehensive framework for developing and evaluating TSC10 inhibitors includes multiple complementary approaches:

High-Throughput Screening Strategies:
Several screening methodologies can be employed to identify initial hit compounds:

  • Enzyme-based assays monitoring NADPH consumption offer high throughput but may miss compounds requiring cellular context

  • Phenotypic screens using TSC10-dependent yeast strains can identify bioactive compounds with good cellular permeability

  • Fragment-based screening against purified TSC10 can identify chemical scaffolds for subsequent optimization

  • Virtual screening against structural models can prioritize compounds for experimental testing

Structure-Activity Relationship Development:
Once hit compounds are identified, medicinal chemistry optimization should focus on:

  • Improving selectivity for fungal TSC10 over mammalian counterparts

  • Enhancing cellular penetration while maintaining activity against the membrane-bound enzyme

  • Optimizing pharmacokinetic properties while preserving antifungal activity

  • Development of photoaffinity probes to confirm binding sites and mechanism of action

Combination Therapy Evaluation:
TSC10 inhibitors show particular promise in combination approaches:

  • Synergy testing with existing azoles is essential, as sphingolipid pathway inhibition often enhances azole activity

  • Combinations with echinocandins may target both cell wall and membrane integrity simultaneously

  • Time-kill kinetics with different combination ratios help optimize dosing strategies

  • Checkerboard assays should include resistant clinical isolates to assess resistance-breaking potential

Resistance Development Assessment:
Proactive evaluation of resistance potential is crucial:

  • Serial passage experiments in sub-inhibitory concentrations to assess resistance development frequency

  • Whole-genome sequencing of resistant mutants to identify resistance mechanisms

  • Engineered expression of candidate resistance genes to confirm their contribution

  • Competition assays to quantify fitness costs associated with resistance mechanisms

Translational Considerations:
Moving from in vitro to in vivo evaluation requires:

  • PK/PD studies establishing effective concentrations in relevant tissues

  • Infection model selection appropriate for C. glabrata (murine disseminated candidiasis models)

  • Biomarker development to monitor target engagement in vivo

  • Toxicology screening focusing on potential off-target effects on host sphingolipid metabolism

The most successful approaches integrate these methods, beginning with biochemical understanding of TSC10 and progressing through iterative cycles of compound optimization and biological evaluation. Research should particularly focus on investigating synergy with existing antifungals given that "C. glabrata infections can be difficult to treat and are often resistant to many azole antifungal agents, especially fluconazole" .

What in vivo models are most appropriate for studying TSC10 function in C. glabrata pathogenesis?

Several complementary in vivo models provide insights into TSC10's role in C. glabrata pathogenesis, each with specific advantages for different research questions:

Murine Systemic Infection Model:
This model is the gold standard for studying disseminated candidiasis:

  • Implementation: Tail vein injection of C. glabrata (typically 1×10⁷-5×10⁷ cells per mouse)

  • Readouts: Fungal burden in kidneys, liver, and spleen; survival time; inflammatory markers

  • Advantages: Mimics human disseminated infection; allows assessment of organ-specific pathology

  • Limitations: C. glabrata shows lower virulence compared to C. albicans, requiring higher inoculum

  • TSC10 Relevance: Ideal for studying how TSC10 mutations affect tissue invasion and persistence

Murine Vaginal Candidiasis Model:
This model is particularly relevant as vaginal candidiasis is a common clinical presentation:

  • Implementation: Intravaginal inoculation in estrogen-treated female mice

  • Readouts: Fungal burden in vaginal lavage; local inflammatory response; histopathology

  • Advantages: Mimics common clinical infection; allows longitudinal sampling

  • Limitations: Requires estrogen treatment; strain-dependent colonization efficiency

  • TSC10 Relevance: Useful for studying TSC10's role in mucosal adhesion and persistence

Galleria mellonella Larvae Model:
This invertebrate model offers advantages for high-throughput screening:

  • Implementation: Injection of C. glabrata into the hemocoel of wax moth larvae

  • Readouts: Survival curves; melanization response; hemocyte function

  • Advantages: Inexpensive; ethical advantages; allows larger sample sizes; 37°C incubation

  • Limitations: Limited genetic tools; anatomical differences from mammals

  • TSC10 Relevance: Valuable for initial screening of TSC10 mutants and inhibitor efficacy

Ex Vivo Human Tissue Models:
These models bridge the gap between in vitro and in vivo studies:

  • Implementation: Infection of human tissue explants (vaginal, oral, intestinal)

  • Readouts: Adhesion efficiency; invasion depth; tissue damage; immune cell recruitment

  • Advantages: Uses human tissue; maintains tissue architecture; includes diverse cell types

  • Limitations: Short viability window; donor variability; limited systemic responses

  • TSC10 Relevance: Excellent for studying how TSC10-dependent sphingolipids affect host-pathogen interactions

Comparison of Model Characteristics:

ModelTechnical ComplexityPhysiological RelevanceThroughputCost
Murine SystemicHighVery HighLowHigh
Murine VaginalModerateHighModerateModerate
G. mellonellaLowLow-ModerateHighLow
Human Ex VivoHighHighLowHigh

Research has confirmed that "two established animal models (systemic and vaginal) have been established to study treatment, pathogenesis, and immunity" . The choice of model should be guided by the specific research question, with multiple models often providing complementary insights into TSC10's role in pathogenesis .

How can researchers address experimental challenges when studying the relationship between TSC10, sphingolipid metabolism, and azole resistance?

Researchers face several challenges when investigating TSC10's role in sphingolipid metabolism and azole resistance. Below are methodological approaches to address these challenges:

Challenge 1: Membrane Protein Biochemistry
Working with TSC10 presents difficulties typical of membrane proteins:

  • Solution: Use carefully optimized detergent extraction methods. Research indicates that a combination of digitonin for initial extraction followed by LMNG for purification preserves activity.

  • Alternative approach: Nanodiscs or styrene-maleic acid lipid particles (SMALPs) maintain a native-like lipid environment around the purified protein.

  • Validation method: Compare enzyme kinetics between different preparation methods to ensure native-like activity is preserved .

Challenge 2: Sphingolipid Quantification
Sphingolipids are structurally diverse and challenging to quantify:

  • Solution: Employ targeted lipidomics using LC-MS/MS with internal standards for each sphingolipid class.

  • Alternative approach: Use sphingolipid-binding probes (fluorescently labeled) for imaging-based analysis of subcellular distribution.

  • Emerging technique: Novel derivatization strategies targeting the primary amine group of sphingoid bases improve detection sensitivity by 10-15 fold .

Challenge 3: Genetic Manipulation
C. glabrata's haploid genome makes essential gene studies difficult:

  • Solution: Implement conditional expression systems (tetracycline-controlled or auxin-inducible degron tags) for essential genes like TSC10.

  • Alternative approach: CRISPR interference (CRISPRi) provides tunable repression without complete gene deletion.

  • Validation strategy: Complementation with wild-type TSC10 should rescue phenotypes associated with conditional mutants .

Challenge 4: Separating Direct and Indirect Effects
Distinguishing direct TSC10 effects from downstream consequences is challenging:

  • Solution: Acute chemical inhibition of TSC10 using selective inhibitors provides temporal control.

  • Alternative approach: Metabolic bypass strategies supplementing downstream metabolites can distinguish direct enzymatic effects from signaling roles.

  • Validation method: Time-course studies tracking primary (direct) and secondary (indirect) effects after TSC10 inhibition .

Challenge 5: Clinical Relevance Assessment
Translating laboratory findings to clinical relevance:

  • Solution: Study collections of clinical isolates with varying azole susceptibilities to correlate TSC10 mutations/expression with resistance profiles.

  • Alternative approach: Patient-derived xenograft models provide insights into how TSC10-targeting approaches might perform in human infections.

  • Validation strategy: Ex vivo drug susceptibility testing of clinical isolates with and without TSC10 inhibitors .

Integrated Experimental Design Framework:
Addressing these challenges requires an integrated experimental approach:

  • Begin with biochemical characterization of wild-type and variant TSC10 proteins

  • Extend to cellular studies examining sphingolipid profiles and stress responses

  • Validate findings in appropriate infection models

  • Correlate with clinical isolate characteristics

  • Develop translational applications based on mechanistic understanding

This framework allows researchers to build a comprehensive picture of TSC10's role while addressing the inherent challenges of studying this membrane-bound enzyme in the context of fungal pathogenesis and drug resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.