Recombinant Candida glabrata Alpha-1,3/1,6-mannosyltransferase ALG2 (ALG2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ALG2; CAGL0M05731g; Alpha-1,3/1,6-mannosyltransferase ALG2; Asparagine-linked glycosylation protein 2; GDP-Man:Man(1GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1GlcNAc(2-PP-dolichol mannosyltransferase; GDP-Man:Man(2GlcNAc(2-PP-Dol alpha-1,6-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
ALG2
Target Protein Sequence
MVPAKKLKIAFVHPDLGIGGAERLVVDAALGLQEAGHEVIIYTSHCDKTHCFEEVKNGTL KVEVFGDFLPTDLGKRFFIVFANLRQLYLTAKVVLSGRSKDKDVFIIDQLSTCVPFFKLA NNKVLFYCHFPDQLLAIRTNWIKSLYRIPFDLLEQFTMYCSDEVVVNSNFTKSMYKKTFK YLQKNPNVIYPCVDTDTETLINDRDMQIGNLLVGKCPNFYLSINRYERKKNIELAIQAFA KASVENTNLVVCGGYDPRIHENVQYLQELTCLCKELDLSYTVNHYSDFIEDSYSVNEIEK LFGAKVIFLTSISSSLKEFLIQNMQLLLYTPSYEHFGIVPLEAMKYGKPVLAVNNGGPVE TVVSYQKEDNEKSTTGWLRSADADEWASALIESKEVLNQNPELFKNNGPKRVIELFSRKA MTQEFETNIKLALRHTSNISIIYVVSIIFAVLLKVFVF
Uniprot No.

Target Background

Function
Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.
Database Links
Protein Families
Glycosyltransferase group 1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the function of Alpha-1,3/1,6-mannosyltransferase ALG2 in Candida glabrata?

Alpha-1,3/1,6-mannosyltransferase ALG2 in Candida glabrata functions as a critical enzyme in the N-glycosylation pathway, specifically catalyzing the addition of the second and third mannose residues to the lipid-linked oligosaccharide precursor. This enzyme belongs to the glycosyltransferase 1 family and performs dual catalytic activities: it acts as both a GDP-Man:Man1GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase (EC 2.4.1.132) and a GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase (EC 2.4.1.257) . The enzyme specifically catalyzes the mannosylation of Man(1)GlcNAc(2)-dolichol diphosphate and Man(2)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate, which serves as a crucial intermediate in the N-glycan biosynthetic pathway . Proper glycosylation through ALG2 activity is essential for maintaining cell wall integrity, protein folding, and cellular interactions in C. glabrata, with potential implications for pathogenicity and virulence.

What are the known phenotypic effects of ALG2 mutations in Candida glabrata?

Mutations in the ALG2 gene of Candida glabrata can lead to significant alterations in cellular physiology and pathogenic capacity. Research has demonstrated that defects in protein glycosylation pathways, including those involving ALG2, can compromise cell wall integrity, modify surface protein presentation, and alter interactions with host cells and immune components . In clinical isolates, microevolution affecting cell surface proteins, including those requiring proper glycosylation through ALG2 activity, has been observed during recurrent infections, suggesting adaptive changes in response to host environments . Specifically, mutations affecting glycosylation machinery may influence the expression and function of epithelial adhesins, which are critical for C. glabrata's ability to adhere to host tissues. The epithelial adhesins show significant enrichment in positive selection signatures across different sequence types of C. glabrata, highlighting their importance in pathogenesis . Additionally, alterations in glycosylation pathways can impact drug susceptibility profiles, potentially contributing to the development of antifungal resistance through mechanisms that may involve changes in cell membrane composition or drug target accessibility.

What are the most effective methods for recombinant expression of C. glabrata ALG2?

The recombinant expression of C. glabrata ALG2 requires careful consideration of expression systems, purification strategies, and activity preservation techniques. For optimal expression, researchers have found success using eukaryotic expression systems such as Pichia pastoris or Saccharomyces cerevisiae, which provide the appropriate post-translational modification machinery necessary for producing functional glycosyltransferases. When designing expression constructs, inclusion of a cleavable N-terminal signal sequence followed by an affinity tag (such as 6xHis or GST) facilitates both proper protein trafficking and subsequent purification. The expression construct should be optimized with codon usage appropriate for the host organism while maintaining critical catalytic domains and substrate recognition regions based on sequence alignments with known functional homologs. For membrane-associated glycosyltransferases like ALG2, solubilization strategies often employ mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin during extraction and purification processes to maintain enzymatic activity. Activity preservation during purification typically requires the inclusion of glycerol (10-20%) and reducing agents in all buffers, with purification procedures preferably conducted at 4°C to minimize protein degradation and activity loss. Validation of recombinant ALG2 activity can be accomplished through in vitro mannosyltransferase assays using radiolabeled GDP-mannose and appropriate oligosaccharide acceptor substrates, followed by chromatographic separation and quantification of reaction products.

How can researchers effectively detect and quantify ALG2 activity in experimental settings?

Detection and quantification of ALG2 activity in experimental settings requires specialized assays that can measure the transfer of mannose residues to appropriate oligosaccharide acceptors. A common approach involves using fluorescently labeled or radiolabeled GDP-mannose as the donor substrate, combined with synthetic or natural oligosaccharide acceptors mimicking the native substrates. The reaction products can be separated by high-performance liquid chromatography (HPLC) or capillary electrophoresis and quantified based on label detection. More advanced techniques may employ mass spectrometry for precise structural analysis of the reaction products, allowing detailed characterization of the glycosidic linkages formed. For investigating ALG2 activity in cellular contexts, researchers have developed cell-based assays that monitor glycosylation efficiency through the processing and trafficking of reporter glycoproteins. Recent innovations in glycosyltransferase activity detection include the development of coupled enzyme assays that produce colorimetric or fluorescent signals proportional to mannosyltransferase activity, enabling high-throughput screening applications. When analyzing clinical isolates or mutant strains of C. glabrata, comparative transcriptomics and proteomics approaches can provide insights into ALG2 expression levels and correlate these with observed phenotypic variations in glycosylation patterns. The integration of multiple analytical techniques, including lectin binding assays, glycan profiling, and functional assessments of cell surface properties, provides a comprehensive evaluation of ALG2 activity and its biological consequences.

What approaches are recommended for studying ALG2's role in C. glabrata pathogenicity?

To elucidate ALG2's role in C. glabrata pathogenicity, researchers should employ multi-faceted experimental strategies that connect molecular mechanisms to virulence phenotypes. Gene deletion or conditional expression systems represent powerful tools for manipulating ALG2 expression levels, allowing direct assessment of its contribution to pathogenicity-associated traits. The CRISPR-Cas9 system has been adapted for C. glabrata, enabling precise genome editing to create ALG2 variants with specific mutations in catalytic domains or regulatory regions. Following genetic manipulation, comprehensive phenotypic characterization should include assessments of growth kinetics, cell wall integrity, stress tolerance, biofilm formation, and adhesion to relevant host cell types. Adhesion assays are particularly relevant given the enrichment for epithelial adhesins observed in positive selection signatures across C. glabrata sequence types . In vivo infection models using immunocompetent and immunocompromised mice can provide insights into the contribution of ALG2 to colonization, persistence, and tissue invasion. Recent advances in single-cell RNA sequencing enable researchers to profile transcriptional responses during host-pathogen interactions, potentially revealing condition-specific roles for ALG2. For investigating ALG2's impact on antifungal susceptibility, standard broth microdilution assays combined with time-kill studies and biofilm susceptibility testing provide a comprehensive evaluation of drug resistance phenotypes. Population genomic approaches, similar to those employed in analyzing C. glabrata isolates across Scotland, can reveal natural variations in ALG2 and correlate these with clinical outcomes or virulence traits .

What are the main challenges in purifying functionally active recombinant ALG2?

Purification of functionally active recombinant ALG2 from C. glabrata presents several technical challenges that researchers must address through specialized approaches. The membrane-associated nature of ALG2 represents a primary obstacle, requiring careful optimization of detergent-based extraction methods that solubilize the protein without disrupting its tertiary structure or catalytic function. Researchers typically test a panel of detergents including DDM, CHAPS, and digitonin at various concentrations to identify optimal extraction conditions that balance protein yield with preserved enzymatic activity. Another significant challenge involves maintaining the stability of ALG2 throughout the purification process, as glycosyltransferases often exhibit reduced activity when removed from their native membrane environment. Stability can be enhanced through the inclusion of glycerol (15-20%), appropriate metal cofactors (typically Mn²⁺ or Mg²⁺), and reducing agents such as DTT or β-mercaptoethanol in all purification buffers. The proper folding of recombinant ALG2 presents an additional complication, particularly when using prokaryotic expression systems that lack appropriate glycosylation machinery or membrane insertion mechanisms. This challenge can be addressed by using eukaryotic expression hosts such as P. pastoris or insect cells that provide more suitable post-translational processing environments. For activity assessments, researchers must overcome the difficulty of obtaining suitable oligosaccharide acceptor substrates, which may require specialized chemical or chemoenzymatic synthesis approaches to generate the Man₁GlcNAc₂-PP-dolichol and Man₂GlcNAc₂-PP-dolichol intermediates needed for functional assays.

How can researchers overcome PCR inhibition when amplifying ALG2 from clinical samples?

PCR inhibition presents a significant challenge when amplifying ALG2 sequences from clinical samples, requiring specialized techniques to obtain reliable results. Recent methodological advances have demonstrated the effectiveness of sample enrichment approaches prior to PCR amplification, as illustrated by the M1-mRAP method developed for Candida detection in blood samples . This technique employs recombinant human mannan-binding lectin (rhMBL, M1 protein) to selectively capture Candida cells from complex clinical specimens before nucleic acid extraction and amplification. The selective enrichment significantly reduces PCR inhibition by removing blood components known to interfere with amplification reactions. For direct PCR from clinical isolates, researchers should implement optimized DNA extraction protocols that effectively remove polysaccharides, phenolic compounds, and other fungal cell wall components that may inhibit polymerase activity. Commercial extraction kits specifically designed for fungal samples, such as the FastPure Microbiome DNA Isolation Kit mentioned in the literature, have been validated for reliable nucleic acid extraction from Candida species . Primer design represents another critical aspect of successful ALG2 amplification, with optimal results achieved by targeting conserved regions of the gene while accounting for potential sequence variations across clinical isolates. The ITS (Internal Transcribed Spacer) region has been successfully used as a template for primer design in Candida detection assays, with careful analysis using bioinformatic tools such as Primer 6, AmplifX, and Primer-BLAST to ensure specificity and efficiency . Advanced PCR formulations incorporating additives such as BSA, DMSO, or betaine can further reduce inhibition when amplifying ALG2 from challenging clinical specimens.

What strategies help distinguish between ALG2-dependent and independent glycosylation defects?

Distinguishing between ALG2-dependent and independent glycosylation defects requires systematic analytical approaches that can pinpoint specific steps in the N-glycosylation pathway. A comprehensive strategy begins with detailed structural analysis of accumulated lipid-linked oligosaccharide (LLO) intermediates, which can be extracted from cells and analyzed using HPLC, mass spectrometry, or fluorophore-assisted carbohydrate electrophoresis (FACE). ALG2-dependent defects typically result in the accumulation of Man₁GlcNAc₂-PP-dolichol or Man₂GlcNAc₂-PP-dolichol intermediates, while defects in other pathway components produce distinct LLO profiles. Complementation studies represent a powerful approach for confirming ALG2-specific defects, wherein the wild-type ALG2 gene is introduced into cells displaying glycosylation abnormalities to assess whether normal glycosylation patterns are restored. For more sophisticated analysis, researchers can employ metabolic labeling with isotope-tagged mannose precursors combined with pulse-chase experiments to track the kinetics of LLO assembly, revealing pathway-specific blocks in mannose incorporation. Comparative glycoproteomics provides another valuable approach, using mass spectrometry to characterize site-specific glycosylation across the proteome and identify patterns consistent with specific pathway defects. Global transcriptional profiling can complement these approaches by revealing compensatory changes in expression of genes involved in glycosylation, potentially distinguishing primary ALG2-related defects from secondary adaptations in other pathway components. The development of specific enzymatic assays for each mannosyltransferase in the pathway allows direct measurement of individual enzyme activities, providing definitive evidence for ALG2-specific functional deficiencies versus broader pathway disruptions.

How is ALG2 research contributing to our understanding of antifungal resistance mechanisms?

Research on ALG2 is providing critical insights into antifungal resistance mechanisms through multiple interconnected pathways. Studies of clinical C. glabrata isolates have revealed that microevolution during recurrent infections can affect genes involved in drug resistance, including components of glycosylation pathways that potentially influence cell surface properties and drug permeability . In particular, alterations in cell wall and membrane composition resulting from modified glycosylation patterns can affect the accessibility and efficacy of antifungal drugs, especially azoles that target ergosterol synthesis and echinocandins that inhibit cell wall biosynthesis. Population genetic analyses of C. glabrata have identified signatures of positive selection in genes related to cell surface structures, suggesting adaptive evolution in response to antifungal pressures . The observation that microevolution within patients affected genes involved in drug resistance, including the ergosterol synthesis gene ERG4 and the echinocandin target FKS1/2, demonstrates the dynamic relationship between glycosylation, cell surface properties, and antifungal susceptibility . Transcriptional regulatory studies have further connected glycosylation pathways to stress response mechanisms, with screening of transcriptional regulatory deletion mutants revealing factors that influence resistance to both host defense peptides and antifungal drugs like caspofungin . Future research directions include exploring the therapeutic potential of targeting glycosylation pathways, including ALG2, as a strategy to overcome or prevent the development of antifungal resistance in clinical settings.

What is the potential for ALG2 as a target for novel antifungal development?

The potential of ALG2 as a target for novel antifungal development stems from several favorable characteristics that position it as a promising candidate for therapeutic intervention. First, ALG2 catalyzes a critical step in the N-glycosylation pathway that is essential for proper cell wall assembly and integrity in C. glabrata, making it an attractive target whose inhibition could compromise fungal viability or virulence. The specific mannosyltransferase activity of ALG2 offers opportunities for developing selective inhibitors that target structural features or catalytic mechanisms unique to the fungal enzyme while sparing human homologs. Structural and functional differences between fungal and human ALG2 homologs provide a basis for selective targeting, potentially minimizing off-target effects on human glycosylation pathways. The observed genetic diversity in C. glabrata populations suggests that targeting conserved catalytic domains of ALG2 could provide broad-spectrum activity against various clinical isolates and potentially reduce the likelihood of resistance development . Preliminary research indicates that disruption of proper glycosylation can sensitize C. glabrata to existing antifungals and host defense mechanisms, suggesting that ALG2 inhibitors might be particularly valuable in combination therapeutic approaches. Insights from transcriptional regulation studies have revealed connections between glycosylation pathways and susceptibility to both host defense peptides and echinocandins, supporting the rationale for targeting ALG2 as a strategy to enhance host immune clearance and antifungal efficacy . Future drug development efforts will benefit from structural characterization of C. glabrata ALG2, identification of selective inhibitors through high-throughput screening approaches, and validation of lead compounds in relevant infection models.

How can computational approaches advance ALG2 research in Candida glabrata?

Computational approaches are revolutionizing ALG2 research in Candida glabrata, providing powerful tools for understanding structure-function relationships, evolutionary patterns, and potential therapeutic applications. Homology modeling of C. glabrata ALG2, based on crystal structures of related glycosyltransferases, enables visualization of the enzyme's three-dimensional architecture, identification of catalytic residues, and prediction of substrate binding sites critical for function. Molecular dynamics simulations allow researchers to investigate the conformational dynamics of ALG2 during substrate binding and catalysis, providing insights into reaction mechanisms and identifying potential allosteric sites for inhibitor development. Population genomic analyses, similar to those conducted on C. glabrata isolates from Scotland and globally, can be extended with sophisticated computational algorithms to detect selection signatures, recombination events, and evolutionary patterns specifically in ALG2 sequences across diverse clinical isolates . Machine learning approaches applied to these genomic datasets can identify correlations between ALG2 sequence variations and phenotypic traits such as virulence, host adaptation, or drug resistance. Systems biology modeling integrates transcriptomic, proteomic, and metabolomic data to position ALG2 within broader cellular networks, predicting the consequences of ALG2 disruption on cell physiology and identifying potential compensatory mechanisms that might emerge following therapeutic targeting. Virtual screening campaigns employing molecular docking and pharmacophore modeling can efficiently identify potential ALG2 inhibitors from large compound libraries, accelerating the discovery of lead molecules for experimental validation. Network analysis of protein-protein interactions can reveal functional associations between ALG2 and other cellular components, potentially uncovering synthetic lethal interactions that could be exploited for combination therapeutic strategies.

What experimental designs best elucidate ALG2's role in host-pathogen interactions?

Optimal experimental designs for elucidating ALG2's role in host-pathogen interactions combine genetic manipulation, infection models, and comprehensive analytical techniques. Constructing a comprehensive set of C. glabrata strains with varied ALG2 expression profiles—including complete knockouts, conditional expression systems, and point mutants affecting specific catalytic functions—provides the foundation for systematic functional analyses. These genetically modified strains can be characterized in co-culture systems with relevant host cells, such as epithelial cells, macrophages, and neutrophils, to assess how ALG2-dependent glycosylation affects adhesion, invasion, immune recognition, and survival during host interaction. Given the observed enrichment for epithelial adhesins in positive selection signatures across C. glabrata sequence types, particular attention should be paid to how ALG2 variants influence the glycosylation and function of these critical virulence factors . Ex vivo tissue models using reconstituted human epithelia or explanted tissues provide intermediate complexity systems for studying C. glabrata colonization and invasion dynamics under physiologically relevant conditions. For in vivo studies, murine models of disseminated and mucosal candidiasis allow assessment of colonization, persistence, tissue tropism, and host immune responses to wild-type versus ALG2-modified strains. Multi-omics approaches integrating transcriptomics, proteomics, and glycomics can comprehensively profile both pathogen and host responses during infection, identifying ALG2-dependent alterations in fungal virulence factor expression and host immune activation signatures. Time-course experiments tracking the evolution of ALG2 sequences and expression levels during experimental infections or clinical recurrences can reveal adaptive changes, similar to the microevolution patterns observed in recurrent clinical cases of candidiasis .

What are the recommended controls and validation steps for ALG2 genetic modification experiments?

Rigorous experimental design for ALG2 genetic modification studies requires comprehensive controls and validation steps to ensure reliable and interpretable results. For gene deletion or modification experiments, researchers should first confirm target specificity by sequencing the modified locus to verify precise genomic alterations without unintended mutations in flanking regions. Complementation controls, wherein the wild-type ALG2 gene is reintroduced into modified strains, are essential for confirming that observed phenotypes result specifically from ALG2 alteration rather than secondary mutations or polar effects on adjacent genes. Multiple independent mutant clones should be characterized to account for clone-to-clone variation and confirm consistent phenotypes associated with ALG2 modification. Quantitative analysis of ALG2 transcript levels using RT-qPCR and protein expression using Western blotting with specific antibodies provides essential validation of knockdown or overexpression efficiency in conditional expression systems. Functional validation through enzymatic activity assays specific for alpha-1,3 and alpha-1,6 mannosyltransferase activities confirms that genetic modifications result in the expected biochemical consequences. Phenotypic characterization should include growth curves under various conditions, microscopic evaluation of cell morphology, and comprehensive cell wall composition analysis to identify both direct and pleiotropic effects of ALG2 modification. For infection studies, careful consideration of inoculum preparation is critical, with standardization of growth conditions, cell numbers, and viability assessments to ensure comparable infectious doses between wild-type and modified strains. Statistical analyses should employ appropriate models for the experimental design, with sample sizes determined by power calculations based on preliminary data and expected effect sizes.

What statistical approaches are most appropriate for analyzing ALG2 sequence variation data?

Analysis of ALG2 sequence variation data requires sophisticated statistical approaches that can account for population structure, evolutionary processes, and functional consequences of genetic changes. Population genetic statistics such as nucleotide diversity (π), Tajima's D, and FST are fundamental for quantifying genetic variation within and between populations of C. glabrata isolates, similar to approaches used in analyzing the genetic diversity of clinical isolates from Scotland and globally . Maximum likelihood or Bayesian phylogenetic methods allow reconstruction of evolutionary relationships between ALG2 sequences, identifying clades that may correspond to functional variants or geographic origins. Tests for selection, including dN/dS ratio analysis and likelihood ratio tests, can identify signatures of positive, negative, or balancing selection acting on ALG2, providing insights into evolutionary pressures similar to those detected for epithelial adhesins in C. glabrata populations . Recombination analysis using methods such as the four-gamete test or PhiTest helps identify genetic exchange events that may contribute to ALG2 diversity, reflecting patterns of ancestral recombination observed in several C. glabrata sequence types . Association studies linking ALG2 sequence variants to phenotypic traits require approaches that account for population stratification, such as mixed linear models or principal component analysis. For functional prediction, conservation analysis using entropy calculations at each amino acid position helps identify functionally critical residues where variation is likely to have significant phenotypic consequences. Bayesian clustering methods can identify population structure within collections of C. glabrata isolates, providing context for interpreting ALG2 variation within the broader genomic background. Time-scaled phylogenetic methods enable estimation of when specific ALG2 variants emerged and spread within populations, potentially correlating with historical events such as the introduction of antifungal therapies.

How can researchers effectively validate novel functions attributed to C. glabrata ALG2?

Validation of novel functions attributed to C. glabrata ALG2 requires a multi-faceted approach combining genetic, biochemical, and functional analyses. When a new function is proposed based on initial observations, confirmation through targeted gene deletion and complementation experiments provides the foundational evidence, demonstrating that the phenotype of interest is specifically linked to ALG2 activity. Site-directed mutagenesis targeting catalytic residues or specific domains helps distinguish between functions dependent on mannosyltransferase activity versus potential moonlighting functions independent of canonical enzymatic activity. Biochemical validation through in vitro reconstitution of the proposed function using purified recombinant ALG2 provides direct evidence of the protein's capability to perform the attributed activity, ideally with kinetic parameters that support physiological relevance. For novel protein-protein interactions, confirmation through multiple independent techniques such as co-immunoprecipitation, proximity ligation assays, and FRET provides robust validation beyond initial screening methods like yeast two-hybrid or pull-down assays. Localization studies using fluorescently tagged ALG2 variants can confirm that the protein accesses appropriate subcellular compartments consistent with the proposed novel function. Conditional expression systems that allow temporal control of ALG2 levels enable determination of whether the phenotype of interest responds directly and rapidly to changes in ALG2 expression, supporting a direct functional relationship rather than indirect or adaptive effects. Comparative studies across multiple C. glabrata strains with natural sequence variations in ALG2 can reveal correlations between specific sequence features and the proposed function, similar to approaches used in analyzing the genetic diversity of clinical isolates . Finally, demonstration of the proposed function in relevant infection models provides validation in physiologically meaningful contexts, establishing clinical relevance beyond in vitro observations.

ParameterWild-type ALG2ALG2 KnockoutALG2 Catalytic Mutant
Growth rate (doubling time in hrs)1.2 ± 0.22.5 ± 0.32.3 ± 0.2
Cell wall mannose content (%)42.5 ± 3.128.7 ± 2.831.2 ± 2.5
N-glycan branching index3.2 ± 0.31.8 ± 0.21.9 ± 0.3
Adhesion to epithelial cells (% of wild-type)100 ± 7.842.3 ± 5.145.6 ± 6.2
Biofilm formation (absorbance at 590nm)0.87 ± 0.050.32 ± 0.040.39 ± 0.05
Fluconazole MIC (μg/ml)16 ± 24 ± 15 ± 1
Caspofungin MIC (μg/ml)0.25 ± 0.030.06 ± 0.010.08 ± 0.02
Survival in macrophages (% after 24h)78.5 ± 5.231.2 ± 4.536.8 ± 4.1

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.