Recombinant Candida glabrata Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. To request a particular tag, please inform us, and we will prioritize its development.
Synonyms
AIM11; CAGL0I04928g; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
AIM11
Target Protein Sequence
MTVPEIISDGKSTRRNLQKLLFFGATSATLAIAALTSRSIATRKYIPTFFQLNTKIPTFS SKSEAQAALGLSSGLSLGIFAITTTGFCWALDISSASDFKQRMKTLFNTIDEKEYMNDSD PETNKIIEELEALINKK
Uniprot No.

Target Background

Database Links
Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How do researchers isolate and purify recombinant proteins from Candida glabrata?

When isolating recombinant proteins from C. glabrata, researchers typically employ molecular cloning techniques followed by expression system optimization. The process begins with gene identification and amplification through PCR, followed by insertion into suitable expression vectors containing appropriate promoters and selection markers. For protein purification, affinity chromatography is commonly used, particularly with histidine-tagged recombinant proteins that can be purified using nickel or cobalt affinity resins. Size exclusion chromatography is often employed as a secondary purification step to achieve higher purity. Protein expression can be verified using techniques like Western blotting with specific antibodies, while purification quality is assessed through SDS-PAGE and mass spectrometry to confirm identity and purity.

What are the key virulence factors in Candida glabrata and how are they regulated?

The pathogenicity of C. glabrata is primarily attributed to its superior adhesive capabilities and proficiency in biofilm formation . Unlike other Candida species, C. glabrata lacks several typical virulence factors, yet demonstrates an increasing trend in clinical prevalence and elevated mortality .

Key virulence factors include:

  • Cell Surface Hydrophobicity (CSH): Contributes to adhesion capabilities

  • Epithelial Cell Adhesion: Mediated by adhesins like Epa1 and Epa6

  • Biofilm Formation: Creates protective environments resistant to host defenses and antifungals

These virulence factors are regulated by transcription factors such as Mss11, which has been demonstrated to modulate C. glabrata virulence by regulating EPA1 and EPA6 expression . Specifically, Mss11 binds to the upstream regions of EPA1 (approximately 2829 bp upstream) and EPA6 (approximately 2576 bp upstream), as well as to the promoter regions of subtelomeric silencing-related genes SIR4, RIF1, and RAP1 .

How does the newly discovered Yhi1 protein in C. glabrata facilitate interspecies communication with C. albicans?

The recently discovered Yhi1 protein represents a significant advancement in understanding interspecies fungal communication. C. glabrata secretes this unique small protein that specifically induces hyphal growth in C. albicans, a morphological change essential for host tissue invasion . This Yhi1-based interaction is specific to C. glabrata and C. albicans and is not observed with other common Candida species .

Structure-function analyses have revealed a novel functional pentapeptide motif (AXVXH) that is required for Yhi1 activity . Interestingly, despite C. glabrata's preferred asexual reproduction, Yhi1 expression and efflux are regulated through the mating MAPK signaling pathway and the pheromone transporter CgSte6, respectively . This indicates that C. glabrata has repurposed its mating signaling pathway to facilitate interaction with C. albicans .

Experimental validation of this interaction has been conducted using transwell co-culture assay systems that allow co-incubation of the two fungal species in liquid GMM without physical contact. In these experiments, C. glabrata induced true hyphal growth in C. albicans within 3 hours of co-incubation, while C. albicans predominantly developed yeast cells or pseudohyphae in the presence of S. cerevisiae .

What experimental approaches are most effective for studying the regulatory mechanisms of transcription factors in C. glabrata virulence?

The study of transcription factor regulatory mechanisms in C. glabrata requires multiple complementary experimental approaches:

  • Gene Disruption and Complementation: Construction of null mutants (e.g., Δmss11) and complemented strains from standard C. glabrata strains .

  • Phenotypic Characterization:

    • Microbial adhesion to hydrocarbons (MATH) test for cell surface hydrophobicity

    • Adherence assays to measure epithelial cell adhesion

    • Biofilm assays quantifying formation capabilities

    • Scanning electron microscopy for structural visualization

    • Galleria mellonella virulence assay for in vivo pathogenicity assessment

  • Molecular Mechanism Analysis:

    • Transcriptome sequencing to identify regulated genes

    • Quantitative reverse transcription PCR (RT-qPCR) for targeted expression validation

    • Chromatin immunoprecipitation sequencing (ChIP-seq) to map DNA binding sites

For example, in studying Mss11's regulatory role, researchers constructed FLAG-tagged Mss11 and conducted ChIP-seq, which revealed that Mss11 exhibits extensive binding across all chromosomes of C. glabrata. The majority of binding sites (89.01%) were located within promoter regions, with smaller fractions in upstream regions (4.95%), exons (3.30%), and intergenic regions (2.75%) .

How can researchers effectively study the dual regulatory mechanisms of Mss11 on EPA genes in C. glabrata?

Studying the dual regulatory mechanisms of Mss11 on EPA genes requires integrating multiple experimental approaches:

  • ChIP-seq Analysis: FLAG-tagged Mss11 can be used to map genome-wide binding patterns, showing that Mss11 binds approximately 2829 bp upstream of EPA1 and 2576 bp upstream of EPA6 .

  • Expression Analysis of Silencing-Related Genes: RT-qPCR can confirm that in Δmss11 mutants, expression levels of silencing genes (SIR4, RIF1, and RAP1) increase significantly compared to wild-type strains:

    • SIR4: 2.2-fold increase (P < 0.001)

    • RIF1: 3.0-fold increase (P < 0.001)

    • RAP1: 2.1-fold increase (P < 0.001)

  • Luciferase Reporter Gene Assays: Can help validate direct promoter regulation by measuring the impact of Mss11 on reporter gene expression driven by EPA1 and EPA6 promoters.

  • Gene Knockout Techniques: Targeting components of both the promoter-specific and subtelomeric silencing pathways can help dissect the relative contributions of each regulatory mechanism.

Based on these approaches, researchers have hypothesized that Mss11 regulates EPA1 and EPA6 expression through both promoter-specific binding and modulation of subtelomeric silencing pathways .

What are the best experimental models for evaluating C. glabrata virulence factors and protein functions?

Several experimental models have been established for studying C. glabrata virulence:

  • In vitro Models:

    • Adhesion Assays: Using epithelial cell lines to measure adherence capabilities

    • Biofilm Formation Assays: Quantifying biofilm development on various surfaces

    • Transwell Co-culture Systems: For studying interspecies interactions without physical contact

  • In vivo Models:

    • Galleria mellonella Infection Model: An invertebrate model useful for virulence assessment that has shown consistent results with cell-based assays. For example, decreased virulence of Δmss11 mutants observed in this model correlated with reduced cell surface hydrophobicity, epithelial cell adhesion, and biofilm formation in vitro

    • Systemic and Vaginal Models: Established animal models specifically developed for studying treatment, pathogenesis, and immunity of C. glabrata infections

When selecting a model, researchers should consider the specific virulence factor or protein function being studied, as different models may be more appropriate for certain aspects of pathogenesis.

How can researchers apply ChIP-seq to investigate transcription factor binding patterns in C. glabrata?

ChIP-seq methodology for C. glabrata transcription factors can be implemented through the following protocol:

  • Epitope Tagging: Create strains expressing FLAG-tagged transcription factors (e.g., FLAG-tagged Mss11)

  • Chromatin Preparation:

    • Grow C. glabrata cells to mid-log phase

    • Cross-link DNA-protein complexes with formaldehyde

    • Lyse cells and sonicate chromatin to fragments of ~200-500 bp

  • Immunoprecipitation:

    • Incubate sonicated chromatin with anti-FLAG antibodies

    • Capture antibody-TF-DNA complexes using protein A/G beads

    • Wash extensively to remove non-specific binding

  • DNA Recovery and Sequencing:

    • Reverse cross-linking and purify DNA

    • Prepare sequencing libraries using standard NGS protocols

    • Perform high-throughput sequencing

  • Data Analysis:

    • Map reads to the C. glabrata genome

    • Identify enriched peaks compared to controls

    • Analyze peak distribution across genomic features

    • Visualize binding patterns using tools like IGV

This approach has successfully revealed that transcription factors like Mss11 can have extensive binding across the C. glabrata genome, with binding sites predominantly concentrated within specific genomic features .

What biomarker potential does the newly discovered Yhi1 protein offer for diagnosing C. glabrata infections?

The novel C. glabrata protein Yhi1 presents significant potential as a biomarker for diagnosing C. glabrata infections. CgYHI1 is a unique gene that can serve as a highly precise biomarker for rapidly diagnosing C. glabrata in clinical samples . This is particularly valuable because:

  • Diagnostic Challenges: Recent studies highlight increasing incidences of invasive Candida infections as alarming and challenging, mainly due to imprecise diagnosis, especially in multimodal invasive candidiasis without a positive blood culture .

  • Treatment Implications: Given C. glabrata's inherent resistance to first-line antifungal drugs, identification through Yhi1 detection would enable clinicians to opt for a tailored course of antifungals to effectively treat candidiasis .

  • Specificity: The Yhi1-based interaction appears to be specific to C. glabrata and C. albicans, making it a potentially specific biomarker for distinguishing C. glabrata from other Candida species .

Researchers developing diagnostic tools based on Yhi1 should consider multiple detection methods, including PCR-based gene detection, immunoassays targeting the protein itself, or functional assays that detect the hyphal induction in C. albicans as a surrogate marker for Yhi1 activity.

How might understanding the Yhi1-mediated interaction between C. glabrata and C. albicans inform new therapeutic strategies?

The discovery of Yhi1 and its role in interspecies communication opens several therapeutic avenues:

  • Peptide-Based Interventions: The identification of the functional pentapeptide motif (AXVXH) in Yhi1 provides a template for developing synthetic novel antifungal peptides . These could potentially disrupt the interaction between C. glabrata and C. albicans, thereby preventing the hyphal growth induction that facilitates host tissue invasion.

  • Targeting the Mating MAPK Pathway: Since Yhi1 expression is regulated through the mating MAPK signaling pathway in C. glabrata , inhibitors targeting this pathway could potentially reduce Yhi1 production and disrupt interspecies communication.

  • CgSte6 Transporter Inhibition: The pheromone transporter CgSte6 is involved in Yhi1 efflux , making it another potential target for therapeutic intervention. Inhibitors of this transporter could prevent Yhi1 secretion and thereby disrupt the interaction between C. glabrata and C. albicans.

  • Dual-Species Targeting: Therapeutics could be designed to specifically target mixed-species infections, addressing the unique challenges posed by C. glabrata and C. albicans co-infection.

Understanding this interspecies communication mechanism highlights the complexity of polymicrobial infections and emphasizes the need for targeted therapeutic approaches that address the specific interactions between different fungal species in clinical settings.

What are the implications of Mss11's regulatory role for developing new diagnostic and therapeutic approaches for C. glabrata infections?

The elucidation of Mss11's regulatory role in C. glabrata virulence has several important implications for diagnostic and therapeutic development:

  • Diagnostic Biomarkers: Genes regulated by Mss11, particularly EPA1 and EPA6, could serve as diagnostic biomarkers for C. glabrata infections . Expression levels of these genes might correlate with virulence potential and could inform clinical decision-making.

  • Therapeutic Targeting:

    • Adhesin Inhibitors: Since Mss11 regulates adhesins like Epa1 and Epa6 , compounds that inhibit these adhesins could reduce C. glabrata adherence and biofilm formation.

    • Transcription Factor Modulation: Directly targeting Mss11 could potentially downregulate multiple virulence factors simultaneously.

    • Silencing Pathway Intervention: Targeting the subtelomeric silencing pathway components (SIR4, RIF1, and RAP1) that are regulated by Mss11 could provide an alternative approach to modulating virulence.

  • Biofilm Prevention: Given Mss11's role in biofilm formation , strategies targeting this transcription factor could potentially prevent or disrupt biofilms, addressing a major challenge in treating C. glabrata infections.

  • Combination Therapies: Understanding the regulatory networks controlled by Mss11 could inform the development of combination therapies that target both the transcription factor and downstream virulence mechanisms.

These approaches could help address the inherent resistance of C. glabrata to conventional antifungal therapies, potentially improving treatment outcomes for patients with C. glabrata infections.

What are the most promising avenues for future research on protein-mediated virulence in C. glabrata?

Based on current findings, several promising research directions emerge:

  • Expanded Characterization of Interspecies Communication: Further investigation of Yhi1 and potential additional communication molecules between Candida species could reveal new aspects of polymicrobial infections .

  • Structure-Function Relationships: More detailed analysis of the functional domains of virulence-associated proteins like Yhi1 (particularly the AXVXH motif) and transcription factors like Mss11 could inform targeted therapeutic design .

  • Regulatory Network Mapping: Comprehensive mapping of virulence regulatory networks, expanding beyond individual transcription factors to understand the interplay between different regulatory systems .

  • Host-Pathogen Interaction Studies: Investigating how C. glabrata proteins interact with host factors to evade immune responses and establish infection .

  • Resistance Mechanism Exploration: Further characterization of the molecular basis for C. glabrata's innate resistance to azole antifungals .

  • Biofilm Biology: More detailed investigation of the molecular mechanisms underlying biofilm formation and maintenance, which contribute significantly to C. glabrata's virulence and treatment resistance .

  • Translation to Clinical Applications: Development of diagnostic tools and therapeutic strategies based on newly identified virulence factors and regulatory mechanisms .

How might CRISPR-Cas9 and other advanced genetic manipulation techniques accelerate protein function studies in C. glabrata?

CRISPR-Cas9 and other advanced genetic manipulation techniques offer tremendous potential for accelerating protein function studies in C. glabrata:

  • Precise Gene Editing: CRISPR-Cas9 allows for precise modifications to endogenous genes, enabling:

    • Creation of clean gene deletions without marker scars

    • Introduction of point mutations to study specific amino acid contributions

    • Tagging of proteins at endogenous loci for localization and interaction studies

  • Multiplexed Gene Manipulation: Simultaneous editing of multiple genes can help unravel functional redundancy and complex regulatory networks, particularly relevant for studying transcription factors like Mss11 that regulate multiple targets .

  • Inducible Expression Systems: Development of more sophisticated inducible expression systems for C. glabrata would allow temporal control over gene expression, facilitating the study of essential genes and dynamic processes.

  • Genome-Wide Screens: CRISPR-based screens could identify new virulence factors and regulatory elements on a genome-wide scale.

  • Humanized C. glabrata Models: Creating C. glabrata strains expressing human proteins or domains could provide insights into host-pathogen interactions.

  • Synthetic Biology Approaches: Building synthetic regulatory circuits in C. glabrata could help dissect complex pathways like the mating MAPK signaling pathway that regulates Yhi1 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.