Recombinant Candida glabrata Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
AIM36; FMP39; CAGL0M09614g; Altered inheritance of mitochondria protein 36, mitochondrial; Found in mitochondria protein 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-230
Protein Length
Full Length of Mature Protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
AIM36
Target Protein Sequence
ATAPRNDGGELPSIKKLLMIGLAGTAVFVLAVNSLDKQQPKNSYSESEFESLQRLKRKVA LFPGNQLKVYGVLGTEKYNKIVSGGKIVDPRKIIEKHRTTAGDRYEALLNILYDKYGAVE YFDMLPQGLMVKLVSLYMKDNCSEGDTVVILDFPKSIKDASQFETEVAGISKFIVSQKLK DTDICKYYDAVGKLESV
Uniprot No.

Target Background

Database Links
Protein Families
AIM36 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the Altered Inheritance of Mitochondria Protein 36 (AIM36) in Candida glabrata?

AIM36 in Candida glabrata is a mitochondrial protein that plays a role in mitochondrial inheritance and function. Based on homology with Saccharomyces cerevisiae, it is classified as a mitochondrial precursor protein involved in mitochondrial inheritance pathways . The gene is also referenced by alternative names in database annotations, which helps in cross-referencing across different research platforms.

Methodologically, researchers identify and characterize this protein through comparative genomics with related yeast species, particularly its well-studied ortholog in S. cerevisiae. Sequence alignment tools and phylogenetic analysis are typically employed to establish evolutionary relationships and predict functional domains.

How does AIM36 compare between Candida glabrata and Saccharomyces cerevisiae?

While both C. glabrata and S. cerevisiae possess AIM36 proteins, there are notable differences reflecting their divergent ecological niches. S. cerevisiae AIM36 (UniProt ID: Q03798) is primarily associated with mitochondrial function in a non-pathogenic context . In contrast, C. glabrata has evolved as a human commensal and opportunistic pathogen, potentially adapting its mitochondrial proteins for survival within host environments.

To study these differences, researchers typically conduct sequence alignment analysis, protein structure prediction, and comparative functional genomics. These approaches reveal conservation patterns in functional domains while highlighting adaptations specific to C. glabrata's pathogenic lifestyle.

What expression patterns does AIM36 exhibit in Candida glabrata during different growth phases?

AIM36 expression in C. glabrata shows dynamic regulation depending on growth conditions and stressors. Similar to other mitochondrial proteins in pathogenic fungi, AIM36 expression likely responds to changes in carbon source availability, oxygen levels, and host-derived stress factors.

To investigate expression patterns, researchers employ quantitative PCR, RNA sequencing, and reporter gene constructs. When studying expression during host interaction, transcriptomics approaches similar to those used for other C. glabrata virulence genes are applied. For instance, studies on C. glabrata within macrophages have revealed transcriptional reprogramming to utilize alternative carbon sources , and AIM36 may be part of this adaptive response.

What are the recommended protocols for recombinant expression of Candida glabrata AIM36?

For recombinant expression of C. glabrata AIM36, researchers should consider several methodological approaches:

  • Vector selection: Copper-inducible promoters like MTI have been successfully used for controlled expression of C. glabrata proteins . For AIM36, a similar approach can be employed by replacing standard promoters with the MTI promoter through homologous recombination.

  • Expression system: E. coli systems may be suitable for partial protein domains, but yeast expression systems are preferable for full-length protein to ensure proper folding and post-translational modifications.

  • Purification strategy: A two-step purification process using affinity chromatography (His-tag) followed by size exclusion chromatography is recommended for obtaining pure protein preparations.

The methodology should include verification steps such as western blotting and mass spectrometry to confirm protein identity and integrity.

How can CRISPR-Cas9 be optimized for engineering AIM36 mutants in Candida glabrata?

Engineering AIM36 mutants in C. glabrata requires specialized CRISPR-Cas9 protocols adapted for this pathogenic yeast:

  • Guide RNA design: Target sequences should be selected using C. glabrata-specific algorithms to minimize off-target effects. Particular attention should be paid to the mitochondrial targeting sequence versus functional domains.

  • Delivery method: Electroporation with pre-assembled Cas9-gRNA ribonucleoprotein complexes has shown high efficiency in C. glabrata transformation.

  • Selection strategy: For AIM36 studies, a dual-marker system is recommended, combining nutritional selection with fluorescence reporters to facilitate screening.

  • Verification approach: Beyond standard PCR confirmation, mitochondrial localization studies using fluorescence microscopy should be conducted to verify the impact on protein targeting.

When creating deletion mutants, researchers should consider the potential pleiotropic effects on mitochondrial function and virulence, similar to those observed with other C. glabrata virulence determinants .

What role might AIM36 play in Candida glabrata virulence and host interaction?

Based on our understanding of C. glabrata pathogenesis mechanisms, AIM36 may contribute to virulence through several potential pathways:

  • Stress adaptation: Like CgDtr1 transporter which confers resistance to oxidative and acetic acid stress , AIM36 might contribute to stress tolerance through mitochondrial mechanisms.

  • Survival within phagocytes: C. glabrata's distinctive ability to survive and replicate inside phagosomes may partially depend on mitochondrial adaptation proteins like AIM36.

  • Metabolic flexibility: AIM36 could participate in the metabolic reprogramming observed during host interaction, particularly involving alternative carbon source utilization.

Research approaches to investigate these possibilities include creating isogenic AIM36 deletion mutants and testing their virulence in infection models such as Galleria mellonella larvae, similar to methodologies used for studying CgDtr1 . Additionally, co-culture experiments with mammalian phagocytes would reveal AIM36's potential role in intracellular survival.

How does mitochondrial morphology and distribution change in AIM36 deletion mutants of Candida glabrata?

In AIM36 deletion mutants, researchers should examine several aspects of mitochondrial dynamics:

  • Morphology alterations: Using fluorescent mitochondrial markers and high-resolution microscopy to quantify changes in mitochondrial shape, size, and network complexity.

  • Distribution patterns: Employing time-lapse microscopy to track mitochondrial inheritance during cell division, with particular attention to mother-daughter asymmetry.

  • Membrane potential: Measuring mitochondrial functionality using membrane potential-sensitive dyes like JC-1 or TMRM.

  • mtDNA stability: Assessing mitochondrial genome maintenance through qPCR and fluorescence in situ hybridization techniques.

These analyses should be conducted under both standard growth conditions and stress conditions relevant to host environments, such as oxidative stress, carbon source limitation, and acidic pH. The findings would provide insights into AIM36's specific role in C. glabrata mitochondrial dynamics and potentially its contribution to virulence.

What protein interaction partners of AIM36 are critical for its function in Candida glabrata?

Identifying AIM36 interaction partners requires a multi-faceted approach:

  • Proximity labeling techniques: BioID or APEX2 fusions with AIM36 can identify proximal proteins in vivo.

  • Co-immunoprecipitation studies: Using epitope-tagged AIM36 followed by mass spectrometry to identify stable interactors.

  • Yeast two-hybrid screening: Modified for mitochondrial proteins by using appropriate bait constructs.

  • Genetic interaction mapping: Synthetic genetic array analysis to identify functional relationships.

Based on knowledge of mitochondrial protein networks in related yeasts, potential interaction partners may include:

Protein CategoryPotential InteractorsFunctionExperimental Approach
Import machineryTOM/TIM complex componentsMitochondrial importIn vitro import assays
Fusion/fissionFzo1, Dnm1 homologsMitochondrial dynamicsFluorescence microscopy
mtDNA maintenanceAbf2, Mgm101 homologsGenome stabilitymtDNA quantification
Respiratory chainComplex I-V componentsEnergy productionRespiration measurements

Understanding these interactions would provide insights into AIM36's functional role in mitochondrial processes and potentially reveal novel targets for antifungal development.

How can high-throughput phenotypic screening be designed to identify compounds targeting AIM36 function?

A comprehensive high-throughput screening strategy should include:

  • Primary screen design:

    • Reporter system: AIM36 fused to a split fluorescent protein or luciferase reporter to detect disruption of localization or interactions

    • Growth inhibition assays in conditional AIM36 mutants vs. wild-type strains

    • Mitochondrial function assays (membrane potential, ROS production) in 384-well format

  • Secondary screening cascade:

    • Target engagement validation using thermal shift assays with purified recombinant AIM36

    • Specificity assessment against human mitochondrial proteins

    • Efficacy testing in infection models

  • Data analysis approach:

    • Machine learning algorithms to identify structure-activity relationships

    • Network analysis to predict potential off-target effects

    • Clustering methods to classify compounds by mechanism

The screening protocol should include appropriate controls such as known mitochondrial inhibitors and C. glabrata-specific antifungals. Data interpretation should account for the unique metabolic flexibility of C. glabrata compared to other Candida species, particularly its ability to survive in glucose-limited environments .

What are the best protein purification strategies for recombinant Candida glabrata AIM36?

Purifying recombinant C. glabrata AIM36 presents several challenges that require specific methodological considerations:

  • Expression system selection:

    • Pichia pastoris is recommended for expressing full-length AIM36 with native folding

    • The MTI promoter system described for other C. glabrata proteins can be adapted

    • Codon optimization should be performed based on C. glabrata preferred codons

  • Solubility enhancement strategies:

    • Express without the mitochondrial targeting sequence to improve solubility

    • Consider fusion partners such as MBP or SUMO

    • Use mild detergents (0.1% DDM or CHAPS) during extraction

  • Purification protocol:

    • Initial capture: IMAC using Ni-NTA or Co-NTA resin

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography in buffer containing stabilizers

  • Quality control measures:

    • Circular dichroism to confirm secondary structure

    • Dynamic light scattering to verify monodispersity

    • Limited proteolysis to identify stable domains

This multi-step approach maximizes the chances of obtaining functional protein for downstream structural and biochemical studies.

How can researchers effectively analyze AIM36's impact on mitochondrial genome stability in Candida glabrata?

Analyzing AIM36's role in mitochondrial genome stability requires a comprehensive methodological approach:

  • Quantitative mtDNA analysis:

    • qPCR comparing nuclear to mitochondrial genome ratios

    • Long-range PCR to detect large-scale deletions

    • Next-generation sequencing to identify point mutations and small indels

  • Visualization techniques:

    • DAPI staining coupled with MitoTracker for co-localization

    • Fluorescence in situ hybridization with mtDNA-specific probes

    • Super-resolution microscopy for nucleoid organization

  • Functional assays:

    • Oxygen consumption rate measurements

    • ATP production quantification

    • Membrane potential assessment using JC-1 dye

  • Stress response testing:

    • Challenge with ROS-inducing agents

    • Growth on non-fermentable carbon sources

    • Response to mtDNA damaging agents

Researchers should examine these parameters in wild-type, AIM36 deletion, and complemented strains under both normal growth conditions and during host-relevant stresses, such as phagocyte interaction .

What are the recommended controls for studying AIM36 localization in Candida glabrata?

When investigating AIM36 localization, researchers should implement these methodological controls:

  • Positive controls:

    • Known mitochondrial matrix proteins (e.g., Hsp60)

    • Outer membrane markers (e.g., Tom20 homolog)

    • Inner membrane markers (e.g., Tim23 homolog)

  • Negative controls:

    • Cytosolic protein markers

    • ER markers to rule out mislocalization

    • AIM36 with mutated mitochondrial targeting sequence

  • Technical validation approaches:

    • Orthogonal methods: combine fluorescence microscopy with subcellular fractionation

    • Multiple tagging strategies: N-terminal vs. C-terminal tags with linkers

    • Verification in different growth conditions to rule out artifacts

  • Quantitative assessment:

    • Pearson's correlation coefficient for co-localization

    • Manders' overlap coefficient for partial co-localization

    • Line scan analysis across mitochondria

These controls ensure that observations regarding AIM36 localization are robust and physiologically relevant, particularly when examining dynamic changes during stress or host interaction.

How should researchers interpret conflicting data about AIM36 function between in vitro and in vivo studies?

When facing discrepancies between in vitro and in vivo findings for AIM36 function, researchers should consider:

  • Context-dependent regulation:

    • Host factors may modulate AIM36 function

    • Nutrient availability differs significantly between laboratory media and host environments

    • Similar to observations with CgDtr1, which shows environment-specific phenotypes

  • Methodological reconciliation approach:

    • Develop intermediate models that bridge in vitro and in vivo conditions

    • Use ex vivo systems like isolated phagocytes or tissue explants

    • Implement conditional expression systems to test timing-dependent effects

  • Data integration framework:

    • Weight evidence based on methodological rigor

    • Consider evolutionary conservation patterns with S. cerevisiae AIM36

    • Evaluate consistency with known C. glabrata adaptation mechanisms

  • Experimental validation strategy:

    • Design experiments specifically addressing the discrepancy

    • Use multiple independent methods to test the same hypothesis

    • Collaborate with groups using different model systems

What statistical approaches are most appropriate for analyzing phenotypic data from AIM36 mutant studies?

For robust statistical analysis of AIM36 mutant phenotypes, researchers should implement:

The statistical approach should be tailored to the specific phenotype being measured, with careful attention to assumptions underlying each test and appropriate reporting of p-values and effect sizes.

How might single-cell technologies advance our understanding of AIM36 function in heterogeneous Candida glabrata populations?

Single-cell technologies offer transformative opportunities for AIM36 research:

  • Single-cell RNA-seq applications:

    • Reveal population heterogeneity in AIM36 expression

    • Identify co-regulated gene networks at single-cell resolution

    • Track transcriptional dynamics during host interaction

  • Single-cell proteomics approaches:

    • Mass cytometry (CyTOF) with metal-labeled antibodies against AIM36

    • Imaging mass spectrometry for spatial protein distribution

    • Single-cell Western blotting for protein isoform analysis

  • Spatial transcriptomics implementations:

    • Visualize AIM36 expression patterns in biofilms

    • Map expression during tissue invasion

    • Correlate with local microenvironmental conditions

  • Microfluidic applications:

    • Track individual cells' phenotypes over time

    • Isolate rare subpopulations with distinct AIM36 functionality

    • Create controlled gradients to simulate host environments

These technologies can reveal how AIM36 function contributes to the phenotypic diversity that enables C. glabrata to adapt to various host niches and potentially contribute to its virulence mechanisms .

What is the potential role of AIM36 in Candida glabrata biofilm formation and antifungal resistance?

The connection between AIM36, biofilm formation, and antifungal resistance represents an important research frontier:

  • Hypothesized mechanisms:

    • Mitochondrial function regulation during biofilm maturation

    • Stress response coordination during antifungal exposure

    • Metabolic adaptation to the biofilm microenvironment

  • Experimental approaches:

    • Comparative biofilm assays between wild-type and AIM36 mutants

    • Confocal microscopy with fluorescent reporters to track AIM36 within biofilm structure

    • Antifungal susceptibility testing of planktonic versus biofilm cells

  • Clinical relevance assessment:

    • Correlation of AIM36 expression with treatment outcomes

    • Analysis of isolates from persistent infections

    • Evaluation of combinatorial therapies targeting mitochondrial function

  • Potential applications:

    • Biomarkers for biofilm-associated infections

    • Novel therapeutic targets bypassing conventional resistance mechanisms

    • Diagnostic tools for treatment-resistant strains

This research direction may reveal unexpected connections between mitochondrial inheritance proteins and the complex multicellular behaviors that contribute to C. glabrata's clinical importance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.