Recombinant Candida glabrata Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
INA17; CAGL0H05819g; Inner membrane assembly complex subunit 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-164
Protein Length
Full Length of Mature Protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
INA17
Target Protein Sequence
SPEVDNSKIKTLEDLTRLETLEGVDPELIKRLINEKTQEFNTQDELKLLKSMQMEQDRLN EVPLKRFTRPLWIFILMASTFYLGAHLVWWKLAYEKKEVELKHKVDSLETTLKDVMKEKA TGPTPCNNKKSWYKFW
Uniprot No.

Target Background

Function
A component of the mitochondrial inner membrane associated complex (INAC) crucial for the biogenesis of the mitochondrial F1F0-ATP synthase. INAC facilitates the assembly of the peripheral stalk and promotes the integration of the catalytic F1-domain with the membrane-embedded F0-domain.
Database Links
Protein Families
INA17 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the genetic diversity of mitochondrial proteins in clinical Candida glabrata isolates?

Clinical isolates of C. glabrata exhibit remarkable genetic diversity, with at least 19 separate sequence types previously identified globally, plus newly discovered types emerging in regional studies. Genome analysis of 68 isolates from 8 hospitals across Scotland, complemented by 83 global isolates, has revealed that C. glabrata mitochondrial genomes are particularly diverse, with reduced conserved sequences and conserved protein-encoding genes in non-reference ST15 isolates . This diversity indicates potential variations in mitochondrial proteins like AIM43 across different clinical strains and geographic regions, which may impact protein function and expression.

The mitochondrial genome diversity in C. glabrata stands in contrast to the relatively more conserved nuclear genome, suggesting unique evolutionary pressures on mitochondrial proteins. Researchers investigating AIM43 should account for this strain-specific variation by establishing baseline sequence and expression data across multiple reference strains.

How do recombination events affect mitochondrial protein expression in C. glabrata?

Recombination events significantly impact mitochondrial protein expression in C. glabrata. Several sequence types show evidence of ancestral recombination, suggesting that transmission between distinct geographical regions has coincided with genetic exchange arising in new clades . This genetic exchange can affect the regulation and expression of mitochondrial proteins like AIM43.

When studying AIM43 expression, researchers should consider the recombination history of their isolates. Methodologically, this requires combining phylogenetic analysis with expression studies to determine whether specific recombination events correlate with altered AIM43 expression patterns. Quantitative real-time reverse-transcription PCR as described for other genes in C. glabrata can be adapted for AIM43 expression analysis . When analyzing expression data, researchers should normalize against stable reference genes like RND5.8, which is commonly used in C. glabrata studies.

What protocols are recommended for amplification and sequence analysis of AIM43 in C. glabrata?

For effective amplification and sequence analysis of AIM43 in C. glabrata, researchers should adopt a similar approach to that used for other resistance-related genes. The open reading frame (ORF) of AIM43 should be amplified with specifically designed primers, similar to the methodology used for PDR1, ERG11, FKS1, and FKS2 genes .

A recommended protocol includes:

  • Design primers specific to the AIM43 gene regions of interest

  • Amplify the target sequence using PCR with optimized conditions

  • Sequence the amplified products using both forward and reverse primers

  • Analyze sequences against reference strains using alignment tools like Clustal Omega

  • Detect single nucleotide polymorphisms (SNPs) that may affect protein function

When designing primers, researchers should include both outer primers for full-gene amplification and internal walking primers for sequencing, especially if the gene is large, as demonstrated in the FKS1/FKS2 sequencing approach .

How can researchers effectively study the impact of AIM43 mutations on mitochondrial function in C. glabrata?

Studying the impact of AIM43 mutations on mitochondrial function requires an integrated experimental approach:

  • Gene Editing Systems: Use CRISPR-Cas9 or traditional homologous recombination techniques to introduce specific mutations into AIM43. When designing these experiments, researchers should target conserved domains identified through bioinformatic analysis.

  • Mitochondrial Function Assays: After generating mutant strains, assess mitochondrial function through:

    • Oxygen consumption rate measurements

    • Mitochondrial membrane potential assays

    • ATP production quantification

    • Reactive oxygen species (ROS) detection

  • Complementation Studies: Confirm phenotype specificity by reintroducing wild-type AIM43 to rescue mutant phenotypes.

The experimental design should include appropriate controls, particularly wild-type strains and strains with mutations in functionally related genes. Similar to studies on POLG mutations, researchers could explore whether AIM43 mutations affect mtDNA maintenance, potentially causing increased petite frequency (respiratory-deficient colonies) . Treating cells with antioxidants and assessing rescue effects could help determine if oxidative damage is a consequence of AIM43 dysfunction, as has been demonstrated with other mitochondrial proteins .

What methods are recommended for analyzing the relationship between AIM43 expression and antifungal resistance in C. glabrata?

To analyze the relationship between AIM43 expression and antifungal resistance:

  • Expression Analysis: Using quantitative RT-PCR with specific primers and probes for AIM43, compare expression levels between susceptible and resistant isolates. Design primers following the format shown in Table 1 from the literature :

PrimersSequences (5′-3′)Purposes
AIM43-F[Forward primer sequence]AIM43 amplification and expression analysis
AIM43-R[Reverse primer sequence]AIM43 amplification and expression analysis
AIM43-pr6FAM-[Probe sequence]-TAMRAReal-time PCR for AIM43
  • Drug Susceptibility Testing: Determine minimum inhibitory concentrations (MICs) for multiple antifungal classes using standard CLSI methodologies, including broth microdilution, E-test, and disk diffusion assays .

  • Gene Knockout/Overexpression: Create AIM43 deletion mutants and overexpression strains to directly assess the impact on drug susceptibility.

  • Correlation Analysis: Statistically analyze the relationship between AIM43 expression levels and MIC values across multiple isolates using two-way ANOVA similar to approaches used in other C. glabrata studies .

If AIM43 is involved in drug efflux or stress response pathways, researchers should also test its expression response to drug exposure by treating cultures with different antifungals (e.g., azoles, echinocandins) for 3-4 hours before RNA extraction, as described for other genes .

How can researchers distinguish between primary and secondary effects of AIM43 mutations in C. glabrata phenotypes?

Distinguishing primary from secondary effects of AIM43 mutations requires careful experimental design:

  • Temporal Analysis: Monitor cellular changes after inducing AIM43 expression/repression using time-course experiments to identify which phenotypes appear first.

  • Genetic Interaction Studies: Perform systematic genetic interaction screens to identify genes that interact with AIM43. Strong epistatic interactions suggest genes in the same pathway or process.

  • Domain-Specific Mutations: Create mutations in different functional domains of AIM43 to determine if specific phenotypes map to particular protein regions.

  • Metabolomic Profiling: Compare metabolite profiles between wild-type and AIM43 mutant strains to identify the earliest biochemical changes.

  • Suppressor Screens: Identify suppressors of AIM43 mutant phenotypes, which can reveal compensatory pathways.

To implement this approach effectively, researchers should establish clear phenotypic readouts for AIM43 dysfunction. Based on studies of other mitochondrial proteins in Candida species, potential readouts might include changes in respiration, morphology, stress resistance, or mtDNA stability .

How does microevolution within patients affect AIM43 and other mitochondrial proteins during recurrent Candida glabrata infections?

Methodologically, researchers should:

  • Collect sequential isolates from patients with recurrent C. glabrata infections

  • Perform whole-genome sequencing to identify mutations

  • Focus analysis on mitochondrial genes, including AIM43

  • Compare mutation rates in mitochondrial genes versus nuclear genes

  • Correlate genetic changes with phenotypic shifts in virulence or drug resistance

The enrichment pattern observed in clinical isolates suggests that researchers should pay particular attention to nonsynonymous substitutions and frameshift mutations when analyzing AIM43 evolution, as these types of mutations have been identified as particularly relevant in the adaptation of C. glabrata during chronic infection .

What signatures of positive selection can be identified in AIM43 across different C. glabrata sequence types?

Signatures of positive selection have been identified in every C. glabrata sequence type examined, with particular enrichment in genes encoding epithelial adhesins that facilitate fungal adhesion to human epithelial cells . When investigating AIM43 for similar signatures, researchers should:

  • Sequence Comparison: Obtain AIM43 sequences from multiple sequence types of C. glabrata

  • Evolutionary Analysis:

    • Calculate dN/dS ratios to detect positive selection

    • Use programs like PAML, FEL, or MEME to identify specific codons under selection

    • Analyze the distribution of polymorphisms versus fixed differences between clades

  • Structural Mapping: Map positions under selection onto predicted protein structures to identify functional domains under evolutionary pressure

If AIM43 shows signatures of positive selection similar to adhesins, this would suggest a potential role in host adaptation, perhaps through modulation of cellular stress responses or metabolism during host infection. The methodology should include statistical validation of selection signals, as evolutionary analysis can be sensitive to alignment quality and sequence sampling.

How does genetic exchange and recombination in C. glabrata affect the evolution of mitochondrial proteins like AIM43?

Evidence suggests that transmission between distinct geographical regions has coincided with genetic exchange arising in new clades of C. glabrata . This recombination may be a significant driver of evolutionary innovation in mitochondrial proteins like AIM43. To study this phenomenon:

  • Population Genetics Approach:

    • Analyze AIM43 sequences from globally diverse isolates

    • Use recombination detection programs (RDP, GARD) to identify potential recombination breakpoints

    • Construct haplotype networks to visualize gene flow between populations

  • Functional Consequences Assessment:

    • Express recombinant variants of AIM43 in a neutral background

    • Test for functional differences in mitochondrial performance

    • Assess whether recombined variants show novel phenotypes

Three C. glabrata isolates missing MATα1 (potentially representing a second mating type) have been identified , which might provide insights into the mechanisms of genetic exchange. Researchers should investigate whether sexual or parasexual processes contribute to AIM43 diversity, particularly in these potentially distinct mating types.

How does AIM43 function potentially relate to drug resistance mechanisms in clinical C. glabrata isolates?

While AIM43 has not been directly implicated in drug resistance, microevolution within patients affects several genes involved in drug resistance, including the ergosterol synthesis gene ERG4 and the echinocandin target FKS1/2 . Given the critical role of mitochondria in cellular stress responses, AIM43 might indirectly influence resistance through:

  • Energy metabolism regulation: Alterations in mitochondrial function could affect ATP-dependent drug efflux

  • Stress response modulation: Mitochondrial proteins often participate in cellular stress response networks

  • Metabolic adaptation: Changes in mitochondrial metabolism might create microenvironments less susceptible to antifungals

To investigate AIM43's potential role in resistance, researchers should:

  • Compare AIM43 expression in susceptible vs. resistant matched isolates

  • Create AIM43 knockout and overexpression strains and test antifungal susceptibility

  • Examine AIM43 expression response to antifungal exposure using RT-PCR methodology similar to that used for CDR1/CDR2 analysis

The methodology should include standard antifungal susceptibility testing protocols as outlined by CLSI, including broth microdilution, E-test, and disk diffusion with appropriate breakpoints for C. glabrata .

What correlation exists between mitochondrial genome diversity and clinical outcomes in C. glabrata infections?

C. glabrata mitochondrial genomes show remarkable diversity, with reduced conserved sequences and protein-encoding genes in non-reference isolates . This diversity might impact clinical outcomes through:

  • Virulence variation: Different mitochondrial types may confer variable virulence properties

  • Treatment response differences: Mitochondrial diversity might correlate with differential responses to antifungals

  • Host adaptation capabilities: Some mitochondrial variants might be better adapted to specific host niches

To investigate these correlations, researchers should:

  • Sequence mitochondrial genomes from clinical isolates with known treatment outcomes

  • Perform comparative genomics to identify mitochondrial markers associated with favorable/unfavorable outcomes

  • Develop a scoring system for mitochondrial genetic features that might predict clinical response

  • Validate findings in prospective clinical studies

This approach is similar to studies of POLG mutations in mitochondrial disease patients, where specific genetic variants are associated with distinct clinical phenotypes and treatment responses . Researchers should be attentive to potential correlations between mitochondrial variants and treatment failure, which could inform personalized treatment approaches.

How might therapeutic targeting of AIM43 or related mitochondrial pathways affect C. glabrata virulence and drug susceptibility?

Therapeutic targeting of mitochondrial proteins represents a potential novel approach for combating resistant C. glabrata infections. Based on studies of other mitochondrial systems:

  • Antioxidant Therapy Potential: Studies of POLG mutations have shown that high petite frequency (mitochondrial dysfunction) could be rescued by treatment with antioxidants or upregulation of ribonucleotide reductase . Similar approaches might be effective if AIM43 dysfunction is associated with oxidative stress.

  • Combination Therapy Design: Targeting mitochondrial function while administering conventional antifungals might increase efficacy. Researchers should:

    • Test combinations of mitochondrial inhibitors with established antifungals

    • Measure synergistic effects using checkerboard assays

    • Assess resistant strain resensitization potential

  • Virulence Modulation: If AIM43 affects virulence factors, targeting it might reduce pathogenicity without directly killing the fungus, potentially reducing selection pressure for resistance.

This therapeutic approach draws parallels to findings in human mitochondrial disease, where patients harboring POLG mutations may benefit from antioxidant therapy due to elevated oxidative damage . Researchers should systematically evaluate the effects of mitochondrial-targeted compounds on C. glabrata growth, virulence, and drug susceptibility using established in vitro and in vivo infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.