Recombinant Candida glabrata ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Candida glabrata ATP synthase subunit a (ATP6) refers to the genetically engineered form of the mitochondrial-encoded protein subunit 6 of the F₀ sector of the F₀F₁-ATP synthase complex. This enzyme is critical for oxidative phosphorylation, catalyzing ATP production by coupling proton translocation across the mitochondrial membrane to ADP phosphorylation . ATP6 is a core component of the F₀ proton channel, directly involved in maintaining the proton gradient required for ATP synthesis .

Molecular Architecture

  • Subunit Role: ATP6 (subunit a) forms part of the F₀ stator, interacting with the c-ring and peripheral stalk subunits (e.g., Atp8p, Atp4p, Atp7p) to stabilize proton flow .

  • Domain Organization:

    • Transmembrane helices: Facilitate proton translocation.

    • Matrix-exposed regions: Interface with the F₁ catalytic head .

Functional Role

  • Drives ATP synthesis by enabling proton-driven rotation of the c-ring, which induces conformational changes in the F₁ domain .

  • Deletion of ATP6 disrupts mitochondrial membrane potential, elevates reactive oxygen species (ROS), and impairs oxidative phosphorylation .

Genetic Manipulation and Heteroplasmy Dynamics

  • Deletion Strategy: ATP6 was deleted in C. glabrata via biolistic transformation using a recoded ARG8 marker flanked by homologous sequences. Transformants retained heteroplasmy (mixed wild-type and Δatp6 mtDNA) under aerobic conditions .

  • Heteroplasmy Stability:

    ConditionLoss Ratio of Δatp6 mtDNA (%)Key Observation
    Aerobic + oligomycin12.0 (t₁₀), 6.2 (t₂₀)Partial retention of Δatp6
    Anaerobic14.0 (t₁₀), 7.1 (t₂₀)Favor loss of Δatp6 mtDNA
    Anaerobic + oligomycin6.1 (t₁₀), 3.4 (t₂₀)Optimal for Δatp6 retention
    Source:

ROS Production and mtDNA Dynamics

  • Strains lacking ATP6 exhibited elevated ROS levels under aerobic conditions:

    • Δatp6 homoplasmic strain: 378.6% higher ROS vs. wild-type at 8 hours .

    • ROS levels normalized after prolonged aerobic growth due to mtDNA loss .

  • Anaerobic conditions minimized ROS, enabling isolation of homoplasmic Δatp6 strains .

Biotechnological and Medical Applications

  • Model for Mitochondrial Disorders: Mutations in human MT-ATP6 are linked to Leigh syndrome and neuropathy . Recombinant C. glabrata ATP6 provides insights into pathogenic mechanisms of ATP synthase defects .

  • Tool for Haploid Yeast Genetics: The heteroplasmy dynamics observed in C. glabrata inform strategies for mtDNA manipulation in non-mating yeast species .

Challenges in Recombinant ATP6 Studies

  • Heteroplasmy Maintenance: Spontaneous loss of transformed mtDNA under aerobic conditions complicates stable strain generation .

  • ROS Sensitivity: High ROS in Δatp6 strains necessitates anaerobic culturing for homoplasmy .

Future Directions

  • Structural Studies: Cryo-EM analysis of recombinant ATP6 to resolve proton channel mechanics .

  • Therapeutic Screening: Use Δatp6 strains to identify compounds mitigating mitochondrial ROS toxicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your product.
Synonyms
ATP6; ATP synthase subunit a; ATP synthase subunit 6; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-260
Protein Length
Full Length of Mature Protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
ATP6
Target Protein Sequence
SPLEQFEVKTFLGLNTPFIDLSGLNITTFTLYTIIVLLVVSSLYVLSNNNNKIIGSRWLL SQEVIYDTILNMVKGQIKGKDWGYYFPFIYTLFMFILISNLISMIPYSYALTAQFVFIIS LSMIIWLGITILSLFKHGWVFFSLFVPSGTALPLVPLLVVIELLSYVARAFSLGLRLSAN IFSGHLLMAILAGLTMTFVQINIFTLILGFIPLAIILIIMCLEFGIAIIQAYVFSILASS YLKDGLYLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for producing ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by the electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. ATP synthase subunit a is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP6 in Candida glabrata?

ATP6 is part of the mitochondrial DNA (mtDNA) of Candida glabrata and encodes subunit 6 (a) of the F₀ sector of mitochondrial F₀F₁-ATP synthase . This protein is essential for the proton-shuttling function of ATP synthase. The ATP synthase complex is a large macromolecular rotary machine of approximately 625 kDa composed of typically 17 different protein subunits . It organizes into a membrane-extrinsic F₁ catalytic domain and a membrane-embedded F₀ domain, which are connected by peripheral and central stalks . Within this complex, ATP6 (subunit a) works together with the c-ring to shuttle protons across the mitochondrial membrane, which is essential for the rotary mechanism that drives ATP synthesis .

How does ATP6 deletion affect mitochondrial function in C. glabrata?

Deletion of the ATP6 gene in C. glabrata significantly impacts mitochondrial function. Strains with partial or complete deletions of ATP6 show markedly increased reactive oxygen species (ROS) production under aerobic conditions compared to wild-type strains . After 8 hours of aerobic growth, ROS production was 207.2% higher in heteroplasmic ATP6/atp6 strains and 378.6% higher in homoplasmic Δatp6 strains compared to ATP6 wild-type strains . This elevated ROS production decreases over time, likely due to complete loss of mitochondrial DNA and interruption of the respiratory chain . The loss of ATP6 affects the integrity of F₀F₁-ATP synthase, disrupting electron transport chain function and oxidative phosphorylation.

What are the experimental approaches for generating recombinant C. glabrata ATP6?

Generation of recombinant C. glabrata ATP6 can be achieved through biolistic transformation of DNA fragments. In published protocols, researchers have used DNA fragments containing a recoded ARG8 mitochondrial genetic marker flanked by homologous arms to the ATP6 gene . Transformants are initially identified by arginine prototrophy (ability to grow without arginine supplementation) . The process typically creates heteroplasmic cells containing both original mtDNA and transformed mtDNA, requiring additional selection steps to obtain homoplasmic strains . For successful generation of recombinant ATP6, researchers should consider optimizing homologous arm lengths (typically 500-1000 bp), transformation parameters, and selection strategies.

How can heteroplasmy be managed in C. glabrata ATP6 transformants?

Managing heteroplasmy in C. glabrata ATP6 transformants requires careful control of growth conditions to selectively favor either original or transformed mtDNA. Research has demonstrated that three key approaches can be used to manipulate mtDNA populations:

  • Aerobic growth: Promotes selective loss of original mtDNA in transformants

  • Anaerobic growth: Favors loss of transformed mtDNA (Δatp6::ARG8)

  • Oligomycin treatment: Addition of sublethal concentrations of oligomycin (a specific inhibitor of FₒF₁-ATPase) during growth affects mtDNA dynamics

Experimental data shows that the loss ratio of transformed mtDNA under aerobic conditions without oligomycin was 44.8% after 10 generations (t₁₀) and 66.1% after 20 generations (t₂₀) . Adding oligomycin during aerobic growth decreased the loss ratio to 12.0% (t₁₀) and 6.2% (t₂₀) . Anaerobic conditions reduced the loss ratio to 14.0% (t₁₀) and 7.1% (t₂₀), while combining oligomycin with anaerobic growth further reduced the loss to 6.1% (t₁₀) and 3.4% (t₂₀) .

Researchers seeking to isolate homoplasmic strains should utilize these approaches based on the desired outcome:

  • To preserve transformed mtDNA: Use anaerobic conditions with oligomycin

  • To promote loss of transformed mtDNA: Use aerobic conditions without inhibitors

What mechanisms explain the differential ROS production in ATP6-deficient C. glabrata strains?

The mechanisms explaining these observations include:

  • Impaired proton pumping: ATP6 deletion disrupts the proton-shuttling function of ATP synthase, potentially causing proton gradient dissipation and electron transport chain dysfunction

  • Electron leakage: Disrupted electron transport chain components increase electron leakage to oxygen, forming superoxide radicals

  • Adaptative response: Extended aerobic culture triggers adaptive responses, including potentially complete loss of mtDNA, which ultimately reduces ROS production

After 24 hours of aerobic growth, ROS levels in homoplasmic Δatp6 strains dropped to only 22.3% of wild-type levels, suggesting that long-term adaptation leads to significant metabolic reprogramming . These findings suggest that ATP6 deficiency triggers initial mitochondrial dysfunction with high ROS production, followed by compensatory mechanisms that decrease ROS generation over time.

How do mutations in C. glabrata ATP6 compare with homologous mutations in other species?

Mutations in ATP6 of different species can provide valuable insights into conserved functional domains and species-specific adaptations. While the search results don't provide specific comparative mutation data for C. glabrata ATP6, we can draw parallels from what is known about ATP6 mutations in other systems.

ATP6 is highly conserved across species, with mutations often affecting similar functional domains. In human mitochondrial disorders, mutations in MT-ATP6 can cause diseases including Leigh syndrome, neuropathy, ataxia, and retinitis pigmentosa (NARP) . Comparative analysis would involve:

  • Sequence alignment: Identifying conserved residues between C. glabrata ATP6 and homologs in humans, S. cerevisiae, and other fungi

  • Functional domain mapping: Based on high-resolution structures, mutations can be mapped to specific functional regions (proton channels, subunit interfaces, etc.)

  • Phenotypic comparison: Evaluating whether similar mutations produce comparable phenotypes across species

Researchers studying C. glabrata ATP6 mutations should consider evolutionary conservation patterns and correlate them with functional impacts observed in other species to gain deeper insights into structure-function relationships.

What protocols effectively differentiate between original and transformed mtDNA in heteroplasmic C. glabrata strains?

Differentiating between original and transformed mtDNA in heteroplasmic C. glabrata strains requires reliable quantification methods. Based on published research, effective protocols include:

  • PCR-based detection: Standard PCR using primers specific to original ATP6 and transformed Δatp6::ARG8 sequences can qualitatively detect the presence of both mtDNA types

  • Quantitative PCR (qPCR): This provides precise quantification of the ratio between original and transformed mtDNA. Primers targeting unique sequences in both mtDNA types are used with appropriate reference genes for normalization

  • Southern blotting: This technique offers visualization of specific mtDNA fragments after restriction enzyme digestion, providing both qualitative and semi-quantitative data on heteroplasmy

For accurate analysis, researchers should employ multiple methods. A recommended approach combines qPCR for numerical quantification with Southern blotting for validation. When performing qPCR, using multiple primer pairs targeting different regions of each mtDNA type improves reliability and helps detect potential recombination events.

How can researchers optimize growth conditions to study ATP6 function in C. glabrata?

Optimizing growth conditions for studying ATP6 function in C. glabrata requires careful consideration of several factors that influence mitochondrial function:

  • Oxygen availability: Shifting between aerobic and anaerobic conditions significantly affects mitochondrial function and mtDNA stability. For studying ATP6 function, researchers should:

    • Use precisely controlled oxygen levels (e.g., using bioreactors with oxygen monitoring)

    • Implement gradual transitions between aerobic and anaerobic conditions

    • Monitor cellular responses at multiple time points (e.g., 8h, 20h, 24h)

  • Carbon source selection:

    • Fermentable carbon sources (glucose): Less reliance on mitochondrial function

    • Non-fermentable carbon sources (glycerol, ethanol): Force cells to rely on mitochondrial respiration

  • Inhibitor concentrations:

    • Oligomycin: Use sublethal concentrations (determined through growth curve analysis) to specifically inhibit F₀F₁-ATPase without killing cells

    • Other respiratory inhibitors can be used as controls to distinguish ATP6-specific effects

Data from previous studies show that combining anaerobic conditions with oligomycin treatment reduces growth by 17.6% compared to aerobic conditions but provides optimal stability for transformed mtDNA . These protocols allow researchers to manipulate mtDNA heteroplasmy ratios to study various aspects of ATP6 function.

What methods can detect interactions between ATP6 and other mitochondrial proteins in C. glabrata?

Detecting protein-protein interactions involving ATP6 presents unique challenges due to its membrane-embedded nature and mitochondrial localization. Effective methodological approaches include:

  • Co-immunoprecipitation (Co-IP) with modifications:

    • Use mild detergents (digitonin, n-dodecyl β-D-maltoside) to solubilize membrane proteins

    • Include crosslinking steps to capture transient interactions

    • Tag interacting proteins rather than ATP6 itself to maintain native ATP6 function

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins expressed in the mitochondria

    • Allows identification of proteins in close proximity to ATP6 without requiring stable interactions

    • Can detect both structural and functional partners

  • Cryo-electron microscopy (cryo-EM):

    • Provides structural insight into ATP6 within the ATP synthase complex

    • Recent high-resolution structures have mapped the topological locations of various subunits

    • Can be combined with site-directed mutagenesis to study specific interactions

These approaches should be complemented with functional assays measuring ATP synthesis, proton transport, or ROS production to correlate physical interactions with functional outcomes. By combining structural and functional analyses, researchers can build comprehensive models of ATP6's role within the ATP synthase complex and potential interactions with other mitochondrial components.

How should researchers interpret changes in ROS production in ATP6-modified C. glabrata strains?

Interpreting changes in ROS production in ATP6-modified C. glabrata strains requires careful consideration of temporal dynamics and cellular context. Research data shows that ROS levels follow a distinct pattern in ATP6-deficient strains:

Initially (8h aerobic growth), ROS levels are dramatically elevated in both heteroplasmic ATP6/atp6 (207.2%) and homoplasmic Δatp6 (378.6%) strains compared to wild-type . With continued aerobic culture, ROS levels progressively decrease, with Δatp6 strains showing only 22.3% of wild-type ROS levels after 24h .

When interpreting these patterns, researchers should consider:

This integrative approach provides a more accurate picture of how ATP6 modifications affect cellular physiology beyond simple ROS measurements.

What statistical approaches best analyze heteroplasmy dynamics in C. glabrata ATP6 transformants?

Analyzing heteroplasmy dynamics in C. glabrata ATP6 transformants requires robust statistical approaches that account for the unique characteristics of mitochondrial populations:

  • Time-series analysis:

    • Fit growth curves to heteroplasmy data across generations

    • Calculate rates of change in mtDNA populations under different conditions

    • Compare dynamics across experimental conditions using repeated measures ANOVA or mixed-effects models

  • Stochastic modeling approaches:

    • Account for the inherent randomness in mitochondrial inheritance

    • Simulate potential outcomes using Markov chain models

    • Compare observed data with model predictions

  • Multivariate analysis:

    • Principal component analysis (PCA) to identify patterns across multiple parameters

    • Cluster analysis to identify distinct heteroplasmy states or trajectories

When analyzing heteroplasmy data from techniques like qPCR, researchers should:

  • Include appropriate technical and biological replicates

  • Use multiple reference genes for normalization

  • Calculate heteroplasmy ratios with confidence intervals

Research data shows that under aerobic conditions, the loss ratio of transformed mtDNA was 44.8% (t₁₀) and 66.1% (t₂₀), while under anaerobic conditions with oligomycin, it decreased to 6.1% (t₁₀) and 3.4% (t₂₀) . These significant differences highlight the importance of proper statistical analysis to accurately characterize heteroplasmy dynamics across conditions.

How can contradictory results in ATP6 function studies be reconciled across different experimental conditions?

Contradictory results in ATP6 function studies often stem from variations in experimental conditions, analytical approaches, and cellular adaptation. Reconciling these contradictions requires systematic analysis:

  • Standardize experimental conditions:

    • Culture media composition

    • Growth phase at analysis

    • Oxygen levels and transitions between aerobic/anaerobic states

    • Duration of experiments (short-term vs. long-term effects)

  • Account for heteroplasmy dynamics:

    • Verify mtDNA composition at each experimental timepoint

    • Consider that heteroplasmy ratios may shift during the experiment

    • Correlate functional outcomes with actual heteroplasmy status rather than initial conditions

  • Distinguish primary from adaptive effects:

    • Immediate consequences of ATP6 deletion (e.g., initial ROS increase)

    • Secondary adaptations (e.g., compensatory mechanisms reducing ROS)

    • Long-term adaptations (potential mtDNA loss)

For example, contradictory findings regarding ROS production (initial increase vs. eventual decrease) can be reconciled by understanding temporal dynamics. Similarly, growth defects might appear inconsistent across studies if heteroplasmy status isn't carefully tracked.

Researchers should implement time-course experiments with multiple parameters measured simultaneously to build comprehensive models that account for the dynamic nature of mitochondrial responses to ATP6 modifications.

What advanced imaging techniques can visualize ATP6 within the C. glabrata mitochondrial membrane?

Visualizing ATP6 within the C. glabrata mitochondrial membrane requires specialized imaging techniques that overcome challenges associated with membrane protein localization and mitochondrial structure:

  • Super-resolution microscopy approaches:

    • Stimulated emission depletion (STED) microscopy: Achieves resolution below the diffraction limit

    • Photoactivated localization microscopy (PALM): Suitable for single-molecule localization

    • Structured illumination microscopy (SIM): Provides enhanced resolution for dynamic studies

  • Electron microscopy-based techniques:

    • Immunogold electron microscopy: Allows precise localization of ATP6 within mitochondrial structures

    • Cryo-electron tomography: Provides 3D visualization of ATP6 in its native membrane environment

    • Correlative light and electron microscopy (CLEM): Combines fluorescence and electron microscopy data

  • Protein tagging strategies for live-cell imaging:

    • Split-GFP approaches: Minimize disruption of ATP6 function

    • Minimal epitope tags: Allow immunodetection with minimal structural impact

    • Site-specific labeling using unnatural amino acid incorporation

When applying these techniques, researchers should validate findings using multiple approaches and correlate structural observations with functional data. Recent high-resolution structures of ATP synthase components provide valuable reference points for interpreting imaging results . The membrane-embedded nature of ATP6 means that visualization techniques must be optimized to distinguish it from other mitochondrial membrane proteins.

What are the most reliable methods for purifying functional recombinant C. glabrata ATP6?

Purifying functional recombinant C. glabrata ATP6 presents significant challenges due to its hydrophobic nature and integration within the ATP synthase complex. Based on current research methodologies, the most reliable approaches include:

  • Whole ATP synthase complex purification:

    • Isolate intact mitochondria from C. glabrata using differential centrifugation

    • Solubilize mitochondrial membranes using gentle detergents (digitonin or n-dodecyl β-D-maltoside)

    • Purify the entire ATP synthase complex using:
      a) Affinity chromatography with tagged subunits other than ATP6
      b) Blue native polyacrylamide gel electrophoresis (BN-PAGE)
      c) Density gradient centrifugation

  • Reconstitution approaches:

    • Express recombinant ATP6 in heterologous systems with appropriate chaperones

    • Purify under denaturing conditions followed by careful refolding

    • Reconstitute into liposomes or nanodiscs to maintain native-like membrane environment

  • Quality control and functional validation:

    • Structural integrity assessment using circular dichroism spectroscopy

    • Activity assays measuring proton transport or ATP synthesis

    • Binding studies with known interaction partners

For all purification approaches, maintaining the native lipid environment is crucial for preserving ATP6 function. Researchers should verify that purified ATP6 retains proper folding and functional capabilities by performing activity assays before using the protein for further studies.

How can researchers effectively measure ATP synthesis in ATP6-modified C. glabrata strains?

Measuring ATP synthesis in ATP6-modified C. glabrata strains requires methods that can distinguish between mitochondrial and glycolytic ATP production. Recommended approaches include:

  • Isolated mitochondria assays:

    • Carefully isolate intact mitochondria from different C. glabrata strains

    • Measure ATP synthesis rates using luciferase-based luminescence assays

    • Compare synthesis rates with and without specific inhibitors:
      a) Oligomycin: Inhibits F₀F₁-ATP synthase
      b) Respiratory chain inhibitors: Block electron transport chain function
      c) Uncouplers: Dissipate the proton gradient

  • Whole-cell approaches:

    • Use selective permeabilization with digitonin to allow substrate access to mitochondria

    • Employ respiratory substrates that specifically feed electrons to different complexes

    • Combine with respiratory inhibitors to isolate mitochondrial ATP contribution

  • Real-time monitoring systems:

    • Genetically encoded ATP sensors (e.g., ATeam, QUEEN)

    • Mitochondria-targeted luciferase constructs

    • Phosphorescence lifetime imaging of oxygen consumption

When interpreting results, researchers should consider:

  • The degree of heteroplasmy in ATP6/atp6 strains

  • Potential compensatory mechanisms in long-term cultures

  • Differences between fermentable and non-fermentable carbon sources

By combining these methodologies, researchers can comprehensively assess how ATP6 modifications affect both the capacity and efficiency of mitochondrial ATP production in C. glabrata strains under various conditions.

How might ATP6 modifications influence antifungal resistance mechanisms in C. glabrata?

The potential relationship between ATP6 modifications and antifungal resistance represents an important frontier in C. glabrata research. Several mechanistic connections warrant investigation:

  • Energy-dependent drug efflux:

    • ATP-binding cassette (ABC) transporters like CDR1, which contribute to azole resistance, require ATP for function

    • ATP6 modifications may alter mitochondrial ATP production, potentially affecting the energy available for drug efflux

    • Researchers should investigate correlations between ATP synthase efficiency and expression/activity of efflux pumps

  • Membrane composition effects:

    • Mitochondrial dysfunction can trigger changes in cellular lipid metabolism

    • Altered membrane ergosterol content (the target of azole antifungals) may result from ATP6 modifications

    • Studies should examine lipid profiles in ATP6-modified strains and correlate with antifungal susceptibility

  • Transcriptional regulation networks:

    • Mitochondrial dysfunction may activate stress response pathways

    • Transcription factors like CgPdr1, which regulate drug resistance genes, may be influenced by mitochondrial status

    • The relationship between mitochondrial genome status and transcriptional activators should be systematically investigated

Future studies should assess minimum inhibitory concentrations (MICs) of various antifungals against ATP6-modified strains, correlate these with ATP production levels, membrane composition, and expression of known resistance factors to establish causal relationships.

What comparative genomics approaches could reveal evolutionary conservation of ATP6 function across Candida species?

Comparative genomics approaches offer powerful insights into ATP6 evolution and functional conservation across Candida species. Recommended strategies include:

  • Sequence-based analyses:

    • Multiple sequence alignment of ATP6 from diverse Candida species

    • Identification of absolutely conserved residues versus species-specific variations

    • Correlation of sequence conservation with known functional domains and mutation hotspots

    • Calculation of selection pressures (dN/dS ratios) across different regions of ATP6

  • Structural comparative analysis:

    • Homology modeling of ATP6 from multiple Candida species

    • Mapping of conserved and variable regions onto 3D structures

    • Identification of species-specific structural adaptations

    • Correlation with known pathogenicity or ecological niches

  • Functional complementation studies:

    • Cross-species ATP6 gene replacement experiments

    • Assessment of whether ATP6 from one Candida species can functionally replace that of another

    • Identification of species-specific functional requirements

These approaches could reveal whether certain ATP6 features correlate with:

  • Species-specific pathogenicity

  • Host adaptation

  • Metabolic capabilities

  • Antifungal susceptibility profiles

By understanding the evolutionary conservation and divergence of ATP6, researchers may identify novel therapeutic targets that exploit species-specific vulnerabilities.

How can systems biology approaches integrate ATP6 function within broader mitochondrial and cellular networks?

Systems biology approaches offer comprehensive frameworks for understanding ATP6's role within broader cellular contexts. Effective integration strategies include:

  • Multi-omics data integration:

    • Transcriptomics: Gene expression changes in ATP6-modified strains

    • Proteomics: Alterations in protein abundance and post-translational modifications

    • Metabolomics: Changes in metabolic profiles, especially energy-related metabolites

    • Network analysis to identify affected pathways and potential compensatory mechanisms

  • Flux analysis approaches:

    • 13C metabolic flux analysis to track carbon flow through central metabolism

    • Oxygen consumption and extracellular acidification measurements

    • Mathematical modeling of ATP production and consumption rates

    • Identification of metabolic rewiring in response to ATP6 modifications

  • Genetic interaction networks:

    • Synthetic genetic array (SGA) analysis with ATP6 modifications

    • Identification of genetic suppressors and enhancers

    • Construction of genetic interaction maps specific to mitochondrial function

These integrative approaches could reveal:

  • How ATP6 dysfunction propagates through cellular networks

  • Compensatory mechanisms activated in response to ATP synthase defects

  • Potential therapeutic targets in pathways that become essential when ATP6 function is compromised

  • Connections between mitochondrial energy production and virulence factor expression

By positioning ATP6 within comprehensive cellular networks, researchers can develop more nuanced understandings of how this critical protein influences both mitochondrial function and broader cellular physiology in C. glabrata.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.