Recombinant Candida glabrata Autophagy-related protein 32 (ATG32)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ATG32; CAGL0H06545g; Autophagy-related protein 32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
ATG32
Target Protein Sequence
MLRFQRGTVKESSSAKLASTSRNGPESSILDPHHSVMELLQRQMEGSEVPSESGVLGESW QQIRESDVGDGGDSNFDQQSNTSAILSSSSEASEDEDLDIQQQLLGGQQEYKNFHMTAEE QLQEQAQGQGFGRPSLLKGTQSRLSEQDSNRSGSVRTIVDKGSCSSSLDEHELNSIFTSD SMSLTKSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS DPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKND AITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRR KKHGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLLYGKAESHHANEAKGFSITNG NSGSSSISHSTEYYESTISQKGLLRNTIVFIKRTIHNLNGKVGTFFASITQVIKQTPVRE DNQFYTLGYMLS
Uniprot No.

Target Background

Function
Recombinant *Candida glabrata* Autophagy-related protein 32 (ATG32) is a mitophagy-specific receptor. It recruits the autophagic machinery to mitochondria, regulating their selective degradation. This process, mitophagy, controls mitochondrial quantity and quality by eliminating excess mitochondria to meet cellular energy demands and prevent excessive ROS production. ATG32 recruits ATG11 to the mitochondrial surface and also promotes autophagy-dependent peroxisome degradation.
Database Links
Protein Families
ATG32 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Vacuole membrane; Single-pass membrane protein. Preautophagosomal structure membrane; Single-pass membrane protein.

Q&A

What is the basic structure and localization of Candida glabrata ATG32?

C. glabrata ATG32 is a 492-amino acid transmembrane protein encoded by the CAGL0H06545g gene. The protein contains specific domains that facilitate interactions with other autophagy-related proteins. It is primarily localized to the outer mitochondrial membrane, where it functions as a receptor for selective mitophagy. The full amino acid sequence includes regions responsible for binding to autophagy machinery components, particularly those involved in recognition and targeting of mitochondria for degradation . The protein's transmembrane domain anchors it to the mitochondrial membrane, while its cytosolic domain interacts with the core autophagy machinery .

How does C. glabrata ATG32 function in mitophagy?

ATG32 functions as an autophagic degron and direct initiator of mitophagy in C. glabrata. The protein harbors a module that mediates crucial interactions with ATG8 and ATG11, key components of the autophagy machinery . Upon appropriate signals (such as iron depletion), ATG32 undergoes phosphorylation, which enhances its interactions with the autophagy machinery . This phosphorylated form of ATG32 serves as a receptor that tags mitochondria for selective degradation through autophagy, thereby facilitating mitochondrial quality control and cellular adaptation to stress conditions . The mechanism appears conserved from yeast to humans, suggesting this is a fundamental process across eukaryotes .

What are the optimal methods for detecting ATG32 phosphorylation status in C. glabrata?

To effectively detect ATG32 phosphorylation status, researchers should employ western blot analysis using hemagglutinin (HA)-tagged ATG32 constructs. Based on published protocols, cells expressing HA-CgATG32 should be cultured in appropriate media (such as YPD overnight), then transferred to iron-replete or iron-depleted media (SD or SD-Fe) .

The phosphorylation status can be confirmed through electrophoretic mobility shift assays, where phosphorylated ATG32 displays higher molecular weight bands. To definitively identify phosphorylation, cellular protein extracts should be treated with lambda protein phosphatase (λPP) as a control . The disappearance of shifted bands after λPP treatment confirms that the mobility shift is due to phosphorylation rather than other post-translational modifications. For optimal results, researchers should collect cell aliquots equivalent to 30 OD600 at specific time points during the experiment .

How can researchers effectively generate and validate ATG32 deletion mutants in C. glabrata?

To generate ATG32 deletion mutants in C. glabrata, researchers should employ targeted gene disruption using homologous recombination. The process involves:

  • Design of disruption cassettes containing a selectable marker (typically antibiotic resistance) flanked by homologous sequences to the ATG32 gene

  • Transformation of C. glabrata cells with the disruption cassette

  • Selection of transformants on appropriate media containing the selective agent

  • Verification of gene deletion through both PCR-based methods and functional assays

For validation, multiple approaches should be employed:

  • PCR confirmation using primers that span the disrupted region

  • Western blot analysis to confirm absence of the ATG32 protein

  • Functional validation by demonstrating impaired mitophagy in the mutant strain

  • Phenotypic characterization under iron-depleted conditions, as Cgatg32Δ mutants show significantly decreased longevity in these conditions

  • Complementation studies by reintroducing the ATG32 gene to restore wild-type phenotypes

What experimental systems are most suitable for studying C. glabrata ATG32 function in virulence?

Based on published research, multiple experimental systems have proven effective for studying ATG32's role in virulence:

In vitro systems:

  • Iron-depletion models using synthetic glucose medium without iron but with chelators like ferrozine (SD-Fe)

  • Nitrogen starvation and H₂O₂ stress models to induce autophagy

  • Chronological aging assays to assess longevity under various stress conditions

Ex vivo systems:

  • Mouse peritoneal macrophage infection models to assess survival after phagocytosis

  • Human THP-1 macrophage infection models to study temporal transcriptional responses

In vivo systems:

  • Mouse models of disseminated candidiasis with intravenous inoculation, followed by assessment of fungal burden in kidneys and spleen

  • Mouse models of intra-abdominal candidiasis

  • Galleria mellonella infection models as alternative in vivo systems

The most informative approach would combine these systems to correlate in vitro phenotypes with in vivo virulence outcomes. Quantitative measurements should include colony-forming unit (CFU) counts from infected organs, survival curves of infected animals, and markers of autophagy induction .

How does the functional relationship between ATG32 and other autophagy proteins differ between C. glabrata and S. cerevisiae?

While ATG32 serves as a mitophagy receptor in both C. glabrata and S. cerevisiae, research has revealed important differences:

What is the relationship between ATG32-mediated mitophagy and mitochondrial membrane potential in C. glabrata?

Research demonstrates a complex relationship between ATG32-mediated mitophagy and mitochondrial membrane potential (MMP) in C. glabrata:

How do the transcriptional profiles differ between wild-type and atg32Δ C. glabrata during host infection?

While specific transcriptional profiling comparing wild-type and atg32Δ C. glabrata during host infection has not been comprehensively conducted, several insights can be derived from existing research:

  • The expression of CgATG32 is significantly upregulated (approximately 6 times greater) in cells recovered from infected mouse kidneys compared to in vitro grown cells . This indicates that host conditions strongly induce ATG32 expression.

  • During infection, C. glabrata undergoes chronological transcriptional responses to adapt to the host environment. Recent research using RNA polymerase II occupancy mapping revealed dynamic responses with specialized pathways activated at different times of infection . Although this study didn't specifically examine atg32Δ mutants, it established that proper temporal regulation of gene expression is critical for successful host adaptation.

  • The decreased virulence of atg32Δ mutants suggests they likely fail to properly regulate essential metabolic pathways during infection. Since iron acquisition is critical during infection and ATG32 is important under iron-depleted conditions, the mutants likely show dysregulated iron-responsive gene expression .

  • Research on other autophagy genes suggests that proper autophagy is necessary for metabolic adaptation during infection. For example, deletion of ATG1, another autophagy gene, affects transcriptional responses related to nutrient acquisition and stress responses .

Further research specifically comparing transcriptional profiles between wild-type and atg32Δ strains during infection would provide valuable insights into the regulatory networks impacted by ATG32-mediated mitophagy.

What are the optimal conditions for expressing and purifying recombinant C. glabrata ATG32 protein?

Based on established protocols for recombinant ATG32 production:

Expression system:

  • E. coli has been successfully used as an expression host for recombinant C. glabrata ATG32

  • For full-length protein (1-492 amino acids), a His-tag fusion approach has proven effective

Expression optimization:

  • The choice of tag (His, GST, or other) should be determined during production process optimization based on protein solubility and yield

  • Expression of membrane proteins like ATG32 often benefits from lower induction temperatures (16-18°C) to improve proper folding

Purification strategy:

  • For His-tagged ATG32, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification step

  • Size exclusion chromatography should be employed as a polishing step to achieve >90% purity

  • Buffer optimization is critical - a Tris-based buffer with 6% trehalose at pH 8.0 has been shown to maintain stability

Storage and handling:

  • The purified protein should be lyophilized or stored in buffer containing 50% glycerol

  • For extended storage, maintain at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles; working aliquots should be stored at 4°C for up to one week

  • If lyophilized, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol addition

How can researchers effectively measure mitophagy flux in C. glabrata, and what are the key controls required?

Measuring mitophagy flux in C. glabrata requires specialized approaches:

Methods for mitophagy detection:

  • Western blot tracking of mitochondrial proteins: Monitor the degradation of mitochondrial marker proteins (e.g., mitochondrial matrix or membrane proteins) over time in response to mitophagy-inducing conditions

  • Fluorescence microscopy approaches:

    • Use fluorescently-tagged mitochondrial proteins and monitor their delivery to vacuoles

    • Employ dual-color systems with differentially labeled mitochondrial and vacuolar markers to visualize mitophagy

  • Biochemical fractionation: Isolate mitochondrial fractions at different time points during iron depletion and quantify protein content changes

Essential controls:

  • Positive controls:

    • Iron-depleted conditions (SD-Fe medium) are established inducers of mitophagy in C. glabrata

    • Treatment with mitophagy-inducing drugs as additional positive controls

  • Negative controls:

    • atg32Δ mutant strains show blocked mitophagy and should be used as negative controls

    • Inhibition of the general autophagy machinery (e.g., atg1Δ) to distinguish mitophagy from general autophagy

  • Inhibitor controls:

    • Use of N-acetyl-L-cysteine (NAC), which has been shown to suppress mitophagy in C. glabrata under iron-depleted conditions

    • Autophagy inhibitors to confirm the dependence on the core autophagy machinery

  • Time course analysis:

    • Mitophagy in C. glabrata shows distinct temporal patterns, with CgAtg32 gradually decreasing and disappearing after 2 days in iron-depleted medium

    • Different time points (0, 1, 2, 5, 7 days) should be analyzed to capture the full dynamics

What methodological approaches can resolve the apparent contradiction between decreased ROS levels and reduced longevity in atg32Δ C. glabrata?

The research presents an apparent paradox: atg32Δ C. glabrata mutants exhibit both lower reactive oxygen species (ROS) levels and reduced chronological lifespan under iron-depleted conditions . To resolve this contradiction, several methodological approaches can be employed:

  • Comprehensive ROS measurement approaches:

    • Employ multiple ROS detection reagents beyond those used in initial studies to capture different ROS species

    • Use organelle-specific ROS probes to distinguish between cytosolic, mitochondrial, and other compartmentalized ROS

    • Perform time-resolved measurements to track dynamic changes in ROS levels throughout chronological aging

  • Mitochondrial function assessment:

    • Measure oxygen consumption rates to assess respiratory capacity

    • Monitor ATP production to evaluate mitochondrial energy generation efficiency

    • Assess mitochondrial network morphology using high-resolution microscopy to identify potential fragmentation or fusion defects

  • Analysis of redox signaling pathways:

    • Investigate whether lower ROS in atg32Δ mutants affects adaptive ROS signaling pathways

    • Measure activation of stress-responsive transcription factors that respond to ROS signals

    • Test if artificial induction of ROS signaling pathways can rescue the longevity defect

  • Investigate the glutathione system:

    • The study showed that N-acetyl-L-cysteine (NAC) treatment restored the decreased chronological lifespan of atg32Δ cells, potentially through glutathione (GSH) synthesis rather than ROS scavenging

    • Directly measure GSH/GSSG ratios in wild-type versus atg32Δ cells

    • Test if direct supplementation of glutathione monoethylester affects longevity in the mutant strain

    • Use L-buthionine-sulfoximine (an inhibitor of glutathione synthesis) to determine if GSH depletion affects the observed phenotypes

  • Metabolomic analysis:

    • Conduct comprehensive metabolomic analysis to identify alterations in metabolic pathways beyond ROS production

    • Focus on iron-sulfur cluster biogenesis and iron-containing metabolites, which may be affected in the absence of proper mitophagy

These methodological approaches would help delineate the complex relationship between ATG32-mediated mitophagy, ROS metabolism, and longevity in C. glabrata, potentially revealing that the reduced lifespan results from metabolic defects rather than direct ROS toxicity.

How might ATG32-mediated mitophagy contribute to antifungal resistance in C. glabrata?

While direct evidence linking ATG32-mediated mitophagy to antifungal resistance is still emerging, several potential mechanisms can be proposed based on current research:

  • Mitochondrial quality control: ATG32-mediated mitophagy maintains mitochondrial health under stress conditions . Since mitochondrial function affects membrane potential and ergosterol biosynthesis (targets of many antifungals), proper mitophagy may contribute to membrane integrity and drug efflux capacity.

  • Stress adaptation: C. glabrata is known for its intrinsic resistance to azole antifungals and ability to survive in host environments . The stress response pathways involving mitophagy may overlap with those mediating drug resistance, as both involve adaptation to challenging conditions.

  • Metabolic flexibility: Research suggests that proper temporal regulation of metabolic pathways is essential for C. glabrata adaptation within hosts . ATG32-mediated mitophagy likely contributes to this metabolic flexibility, potentially enabling the cell to circumvent the metabolic perturbations caused by antifungals.

  • Connection with transcription factors: Recent research identified the transcription factor CgXbp1 as important for both C. glabrata survival in macrophages and fluconazole resistance . Given that autophagy genes are regulated during infection, there may be coordinated regulation between mitophagy and drug resistance pathways through shared transcriptional networks.

  • Host environment adaptation: The decreased virulence of atg32Δ mutants suggests they struggle to adapt to host environments . Similar adaptation mechanisms may be required for surviving antifungal treatment, particularly in the context of host-imposed stresses.

Further research specifically testing the susceptibility of atg32Δ mutants to various antifungals and investigating the molecular mechanisms connecting mitophagy to drug resistance would be valuable for developing novel therapeutic approaches.

What is the potential for using ATG32 as a target for antifungal drug development?

Based on current research, ATG32 presents several characteristics that make it a promising target for antifungal drug development:

  • Essential for virulence: ATG32 deletion significantly reduces C. glabrata virulence in multiple infection models, with decreased fungal burden in kidneys and spleen of infected mice . This indicates that targeting ATG32 could attenuate infection without necessarily killing the pathogen directly.

  • Pathogen specificity: While mitophagy is conserved among eukaryotes, there are significant differences in ATG32 regulation and function between species . These differences could potentially be exploited to develop inhibitors specific to fungal ATG32 with minimal effects on human mitophagy pathways.

  • Role in stress adaptation: ATG32-mediated mitophagy is crucial for adaptation to iron limitation and other stresses encountered during infection . Blocking this adaptation mechanism could render C. glabrata more susceptible to host defense mechanisms and conventional antifungals.

  • Druggable interactions: ATG32 functions through specific protein-protein interactions with ATG8 and ATG11 . These interaction interfaces could potentially be targeted by small molecule inhibitors or peptide mimetics that disrupt mitophagy induction.

  • Combination therapy potential: Given that atg32Δ mutants show decreased survival under stress conditions, ATG32 inhibitors might be particularly effective in combination with conventional antifungals or when used in immunocompromised patients receiving iron chelation therapy.

Challenges for drug development include potential off-target effects on human mitophagy, development of resistance mechanisms, and delivery of inhibitors to the appropriate cellular compartment. Future research should focus on detailed structural characterization of C. glabrata ATG32, especially its interaction domains, to facilitate structure-based drug design approaches.

How do host immune responses interact with ATG32-mediated processes during C. glabrata infection?

The interaction between host immune responses and ATG32-mediated processes during C. glabrata infection is complex and bidirectional:

  • Iron sequestration and mitophagy induction: Host immune cells actively sequester iron through proteins like transferrin as part of nutritional immunity . This iron limitation induces ATG32-mediated mitophagy in C. glabrata, allowing adaptation to the iron-poor environment. The increased expression of CgATG32 in cells recovered from infected kidneys confirms this adaptation occurs in vivo .

  • Macrophage survival mechanisms: C. glabrata can survive and proliferate within macrophages, unlike some other fungi that escape by causing macrophage death . ATG32-mediated mitophagy likely contributes to this intracellular survival by enabling metabolic adaptation. While C. glabrata utilizes glucose within macrophages, it appears to acquire carbon without causing glucose depletion, potentially through autophagy-dependent mechanisms .

  • Temporal transcriptional responses: C. glabrata mounts chronological transcriptional responses during macrophage infection, with different pathways activated at specific times post-infection . ATG32-mediated mitophagy is likely integrated into this temporal program, contributing to the sequential adaptation strategies during infection.

  • ROS defense mechanisms: Phagocytes produce ROS as an antimicrobial mechanism. While ATG32 deletion leads to lower ROS levels in C. glabrata under iron-depleted conditions , the implications for surviving phagocyte-generated oxidative stress remain unclear. This apparent contradiction might reflect different roles of mitophagy in managing endogenous versus exogenous oxidative stress.

  • Impact on fungal recognition: The atg32Δ mutant shows no significant difference in phagocytosis efficiency by macrophages compared to wild-type , suggesting that ATG32-dependent processes don't substantially alter the pathogen-associated molecular patterns recognized by immune cells.

Understanding these interactions could reveal opportunities for therapeutic interventions that enhance host immune control while targeting fungal adaptation mechanisms.

What are the critical unanswered questions regarding C. glabrata ATG32 structure-function relationships?

Despite significant advances in understanding C. glabrata ATG32, several critical questions about structure-function relationships remain unanswered:

  • Phosphorylation sites and kinases: While research has established that CgATG32 is phosphorylated under both standard and iron-depleted conditions , the specific phosphorylation sites and the kinases responsible have not been fully characterized. Identifying these sites and their regulatory kinases would provide valuable insights into how mitophagy is regulated in response to different stressors.

  • Interaction domains: Although ATG32 is known to interact with ATG8 and ATG11 , the precise structural requirements for these interactions in C. glabrata have not been mapped in detail. Determining which domains and residues are essential for these interactions could inform targeted therapeutic approaches.

  • Transmembrane topology: As a mitochondrial outer membrane protein, the exact topology of CgATG32 (which portions face the cytosol versus the intermembrane space) requires further characterization. This information would clarify how it signals from damaged mitochondria to the autophagy machinery.

  • Species-specific structural features: Research indicates functional differences between S. cerevisiae and C. glabrata ATG32 . Detailed structural comparison could reveal C. glabrata-specific features that contribute to its role in virulence.

  • Post-translational modifications beyond phosphorylation: Whether CgATG32 undergoes other modifications (ubiquitination, acetylation, etc.) that regulate its function remains largely unexplored. Such modifications could provide additional regulatory layers for mitophagy induction.

  • Structural changes during mitophagy induction: How the conformation of CgATG32 changes upon mitophagy activation, and whether it undergoes oligomerization or other structural rearrangements during this process, represents an important knowledge gap.

Addressing these questions will require advanced structural biology approaches combined with targeted mutagenesis and functional assays.

How might systems biology approaches advance our understanding of ATG32-mediated mitophagy in fungal pathogenesis?

Systems biology approaches offer powerful tools to unravel the complex role of ATG32-mediated mitophagy in C. glabrata pathogenesis:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data from wild-type and atg32Δ strains under various conditions could reveal how mitophagy influences global cellular networks

    • Temporal multi-omics profiling during infection would identify the cascading effects of ATG32 activity on different cellular processes

  • Network analysis approaches:

    • Protein-protein interaction networks centered on ATG32 would identify novel interacting partners beyond the core autophagy machinery

    • Gene regulatory network reconstruction could reveal transcription factors controlling ATG32 expression and broader mitophagy-related gene programs

    • Metabolic network modeling could predict how ATG32-mediated mitophagy reshapes metabolic fluxes under iron limitation and other infection-relevant conditions

  • Genome-wide genetic interaction screens:

    • Synthetic genetic array analysis using atg32Δ as a query strain could identify genes with functional relationships to ATG32

    • CRISPR-based screens in the presence of mitophagy inducers could reveal genetic dependencies that emerge specifically when mitophagy is required

  • Host-pathogen interaction modeling:

    • Agent-based modeling of C. glabrata-macrophage interactions could simulate how ATG32-dependent adaptations influence infection dynamics

    • Mathematical modeling of iron competition between host and pathogen could predict the importance of mitophagy under different host iron states

  • Comparative systems approach:

    • Cross-species comparison of mitophagy networks between C. glabrata, C. albicans, and non-pathogenic yeasts could identify pathogenesis-specific adaptations

    • Evolutionary analysis of ATG32 across fungal lineages might reveal selection pressures related to pathogenic lifestyles

These approaches would provide a comprehensive understanding of how ATG32-mediated mitophagy is integrated within the broader cellular systems that enable C. glabrata pathogenesis.

What novel experimental techniques might enhance investigation of ATG32 function in in vivo infection models?

Several cutting-edge experimental techniques could significantly advance our understanding of ATG32 function during in vivo infection:

  • In vivo genetic manipulation tools:

    • Development of inducible ATG32 expression/deletion systems that allow temporal control of mitophagy during different infection stages

    • CRISPR interference (CRISPRi) systems for partial ATG32 knockdown to study dose-dependent effects on virulence

    • Site-specific mutagenesis of ATG32 phosphorylation sites or interaction domains to create separation-of-function mutants for in vivo studies

  • Advanced imaging techniques:

    • Intravital microscopy with fluorescently-tagged mitochondria and autophagy markers to visualize mitophagy in real-time during infection

    • Correlative light and electron microscopy (CLEM) to capture ultrastructural details of mitophagy events in infected tissues

    • Super-resolution microscopy to study ATG32 localization and clustering on mitochondria during infection

  • Single-cell approaches:

    • Single-cell RNA sequencing of C. glabrata isolated from infected tissues to capture heterogeneity in ATG32 expression and mitophagy induction

    • Mass cytometry (CyTOF) with mitophagy-specific markers to quantify mitophagy at the single-cell level within infected tissues

    • Spatial transcriptomics to correlate ATG32 expression with tissue microenvironments in infection models

  • Biosensor development:

    • Genetically encoded biosensors for mitophagy flux in C. glabrata that could be monitored non-invasively during infection

    • Iron-sensitive fluorescent probes to correlate local iron availability with ATG32 activation in vivo

    • Split-reporter systems to visualize ATG32 interactions with autophagy machinery components during infection

  • Advanced in vivo models:

    • Humanized mouse models with specific immune defects to better model human C. glabrata infections

    • Tissue-specific iron manipulation in animal models to test the relationship between host iron status and ATG32-dependent virulence

    • Polymicrobial infection models to study how ATG32-mediated processes influence interactions with bacterial pathogens during co-infection

These novel techniques would provide unprecedented insights into the spatiotemporal dynamics of ATG32 function during the infection process, potentially revealing new therapeutic targets and intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.