Recombinant Candida glabrata C-5 sterol desaturase (ERG3)

Shipped with Ice Packs
In Stock

Description

Overview of ERG3 in Candida glabrata

The ERG3 gene in Candida glabrata encodes C-5 sterol desaturase, an enzyme critical for ergosterol biosynthesis. This enzyme catalyzes the introduction of a double bond at the C-5 position of sterol intermediates, converting episterol into ergosta-5,7-dienol. Ergosterol is essential for fungal membrane integrity, and disruptions in its synthesis—such as through ERG3 inactivation—lead to resistance to azole antifungals like fluconazole . Recombinant ERG3 refers to the enzyme produced via heterologous expression systems (e.g., in Saccharomyces cerevisiae or C. albicans mutants) for functional and structural studies.

Functional Role in Azole Resistance

Inactivation of ERG3 in C. glabrata leads to azole resistance by altering sterol biosynthesis:

  • Mechanism: Loss of Erg3 activity prevents the formation of toxic sterol diols (e.g., 14α-methylergosta-8,24(28)-dien-3β,6α-diol) when azoles inhibit Erg11 (lanosterol 14α-demethylase). This allows survival despite drug exposure .

  • Sterol profile changes:

    SterolWild-TypeERG3Δ Mutant
    Ergosterol~88%Absent
    EpisterolTraceAccumulated
    Ergosta-7,22-dienolLowDominant (>50%) .
  • Cross-resistance: Some ERG3 mutations (e.g., D122Y) confer cross-resistance to echinocandins .

4.1. ERG3 Deletion and Phenotypic Effects

  • Azole resistance: Prototrophic C. glabrata erg3Δ strains show 8- to 16-fold increases in fluconazole MICs compared to wild-type .

  • Fitness trade-offs: ERG3 mutants exhibit slower growth rates and reduced competitive fitness in drug-free environments .

  • Hyphal growth: Unlike C. albicans, C. glabrata erg3Δ strains retain normal morphology but show increased susceptibility to membrane stressors .

4.2. Recombinant ERG3 in Functional Studies

  • Heterologous expression: C. glabrata ERG3 expressed in C. albicans erg3Δ/Δ restores ergosterol synthesis and azole susceptibility, confirming functional conservation .

  • Species-specific activity: C. glabrata Erg3 produces less toxic diol than C. albicans Erg3 upon azole exposure, influencing intrinsic drug sensitivity .

Applications in Antifungal Research

  • Drug target validation: ERG3 is a potential target for combination therapies to prevent azole resistance .

  • Mechanistic studies: Recombinant ERG3 enables structure-function analyses to identify residues critical for catalysis or inhibitor binding .

Challenges and Future Directions

  • Compensatory mutations: Clinical ERG3 mutants may acquire secondary mutations (e.g., in ERG11 or FKS1) to offset fitness costs .

  • Structural biology: Cryo-EM or X-ray crystallography of recombinant ERG3 could reveal novel drug-binding sites.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing it.
Synonyms
ERG3; CAGL0F01793g; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
ERG3
Target Protein Sequence
MDLVLETLDHYIFDDVYAKIAPVELQRGIDDSLVNALSLNKIVSNSTLLHETLSITNSLK RVNKDVYGLTPFLFDFTEKTYASLLPRNNLIREFFSLWAVVTVFGLLLYLITASLSYVFV FDRTIFNHPKYLKNQMYLEIKLAVSAIPTMSLLTVPWFMLELNGYSKLYYDVDWEHHGLR KLLIEYATFIFFTDCGIYLAHRWLHWPRVYKALHKPHHKWLVCTPFASHAFHPVDGYFQS LSYHIYPMILPLHKISYLILFTFVNFWSVMIHDGQHMSNNPVVNGTACHTVHHLYFNYNY GQFTTLWDRLGGSYRRPEDSLFDPKLKMDKKVLEKQARETAAYIQEVEGDDTDRVYNTDK KKTN
Uniprot No.

Target Background

Function
Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. This enzyme may contribute to the regulation of ergosterol biosynthesis.
Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of C-5 sterol desaturase (ERG3) in Candida glabrata?

C-5 sterol desaturase (ERG3) in Candida glabrata is an essential enzyme in the ergosterol biosynthesis pathway. It catalyzes the introduction of a C-5,6 double bond in the B-ring of the sterol nucleus, converting episterol to ergosta-5,7,24(28)-trienol in the penultimate step of ergosterol biosynthesis . Ergosterol serves as the main sterol component in fungal cell membranes, providing structural integrity and fluidity, similar to cholesterol in mammalian cells. The proper functioning of ERG3 is critical for maintaining normal membrane composition and function in C. glabrata.

Functional analysis of C. glabrata ERG3 shows that when expressed in C. albicans erg3Δ/Δ mutants, it can restore C-5 sterol desaturase activity, resulting in ergosterol production at levels similar to those seen with native C. albicans ERG3 . This functional complementation confirms the enzyme's core role in sterol biosynthesis across Candida species.

How does C. glabrata ERG3 compare structurally to other fungal C-5 sterol desaturases?

Comparative analysis of C. glabrata ERG3 (CgERG3) with homologs from other fungal pathogens reveals significant structural similarities and differences:

SpeciesProteinIdentity with CaERG3 (%)Functional Equivalence
Candida glabrataCgERG359.4Yes
Candida aurisCaurERG370.3Yes
Cryptococcus neoformansCnERG342.4Yes, but with differences
Aspergillus fumigatusAfERG3AVariableYes
Aspergillus fumigatusAfERG3BVariableYes
Aspergillus fumigatusAfERG3CVariableNo
Rhizopus delemarRdERG3AVariableNo
Rhizopus delemarRdERG3BVariableYes

Phylogenetic analysis indicates that the three Candida desaturases (including C. glabrata ERG3) are closely related, while C. neoformans ERG3 is much more divergent . These structural differences correlate with functional variations in substrate specificity, catalytic efficiency, and their propensity to produce toxic sterol intermediates when the ergosterol pathway is inhibited.

What experimental methods are commonly used to express recombinant C. glabrata ERG3?

To express recombinant C. glabrata ERG3 for functional studies, researchers typically employ the following methodology:

  • Heterologous expression system: The coding sequence of CgERG3 is often adapted for expression in model organisms such as C. albicans erg3Δ/Δ mutant strains .

  • Expression vector construction: The CgERG3 gene is cloned into expression vectors (such as pKE4) that contain strong constitutive promoters like TEF1 (P) .

  • Transcription verification: RT-PCR is employed to confirm comparable levels of transcription of the coding sequence .

  • Transformation methods: Standard yeast transformation protocols using lithium acetate or electroporation can be used to introduce the expression constructs.

  • Selection: Transformants are selected using appropriate markers (auxotrophic or antibiotic resistance) present in the expression vector.

  • Functional validation: The activity of recombinant ERG3 can be verified through:

    • Sterol profile analysis using gas chromatography-mass spectrometry (GC-MS)

    • Restoration of phenotypes in erg3 mutant backgrounds

    • Susceptibility testing to antifungal agents

How do mutations in C. glabrata ERG3 contribute to antifungal resistance?

Mutations in C. glabrata ERG3 play a significant and complex role in antifungal resistance through several mechanisms:

  • Azole resistance: ERG3 mutations can confer resistance to azole antifungals such as fluconazole. When azoles inhibit the 14α-demethylase (encoded by ERG11), a toxic sterol intermediate (14α-methylergosta-8,24(28)-dien-3β,6α-diol) is typically produced through the action of ERG3. Mutations that inactivate ERG3 prevent the formation of this toxic intermediate, allowing fungal growth even in the presence of azoles .

  • Echinocandin cross-resistance: Remarkably, mutations in ERG3 can also confer resistance to echinocandins such as anidulafungin, suggesting a dual role in resistance mechanisms .

  • Mutation-specific effects: The relationship between ERG3 alterations and drug resistance is mutation-dependent. Different types of mutations (missense, frameshift, premature stop) can have varying effects on resistance patterns .

Experimental evidence shows that reintroducing specific ERG3 mutations (e.g., D122Y) into wild-type strains increases resistance to fluconazole, while reverting these mutations restores susceptibility, confirming the direct link between ERG3 mutations and antifungal resistance .

What is the relationship between ERG3 mutations and cross-resistance to multiple antifungal drugs?

Cross-resistance to multiple antifungal classes mediated by ERG3 mutations represents a significant clinical concern and research area:

Analysis of experimentally evolved C. glabrata strains reveals that mutations in ERG3 often underpin cross-resistance patterns between different antifungal classes . Notably:

  • Anidulafungin-adapted strains and fluconazole resistance: All 21 anidulafungin-evolved strains showing cross-resistance to fluconazole (MIC > 256 μg/mL) carried alterations in ERG3 .

  • Statistical association: A significant association exists between ERG3 nonsynonymous mutations and fluconazole resistance in anidulafungin-adapted samples .

  • Resistance mechanism differences: The quantitative contribution of ERG3 mutations to fluconazole resistance differs from that of PDR1 or ERG11 alterations, suggesting distinct resistance mechanisms in fluconazole-adapted versus anidulafungin-adapted strains .

  • Incomplete relationship: Of 28 anidulafungin-adapted samples with ERG3 mutations, 6 carrying premature stop (3), missense (2), and frameshift (1) mutations maintained wild-type levels of susceptibility to fluconazole, indicating that not all ERG3 mutations confer cross-resistance .

This research highlights the complexity of ERG3's role in multidrug resistance and suggests that specific types of ERG3 alterations, rather than complete loss of function, are associated with cross-resistance patterns.

What experimental approaches can be used to investigate the role of specific ERG3 mutations in antifungal resistance?

To investigate how specific ERG3 mutations contribute to antifungal resistance, researchers can employ the following methodological approaches:

  • Site-directed mutagenesis: Introduction of specific mutations (e.g., D122Y) into wild-type ERG3 in C. glabrata strains to assess their phenotypic effects .

  • Mutation reversion studies: Reverting ERG3 mutations to wild-type sequence in resistant strains to confirm the role of the mutation in resistance .

  • Susceptibility testing: Determining minimum inhibitory concentrations (MICs) for various antifungals before and after mutation introduction/reversion .

  • Experimental evolution: Exposing C. glabrata strains to increasing concentrations of antifungal drugs and analyzing the resulting mutations and resistance patterns .

  • Sterol profile analysis: Using GC-MS to analyze changes in sterol composition resulting from ERG3 mutations .

  • Competitive fitness assays:

    • In vitro competition: Comparing growth of ERG3 mutant strains versus wild-type in the presence and absence of antifungal drugs .

    • In vivo competition: Using model organisms like Galleria mellonella to assess competitive fitness of different strains .

  • Stress response testing: Evaluating responses to various stressors (oxidative, membrane, temperature) to understand pleiotropic effects of ERG3 mutations .

These approaches, used in combination, can provide comprehensive insights into the mechanistic basis of ERG3-mediated antifungal resistance.

How does C. glabrata ERG3 activity compare to ERG3 homologs from other fungal pathogens?

C. glabrata ERG3 exhibits distinct functional characteristics compared to homologs from other fungal pathogens:

SpeciesC-5 Desaturase ActivityErgosterol Content (%)Stress/Hyphal Growth RestorationFluconazole MIC (μg/ml)Trailing Growth at Supra-MICs
C. albicans (CaERG3)High~88%Complete0.25Low
C. glabrata (CgERG3)Lower than CaERG3ReducedPartial0.5Slightly higher
C. auris (CaurERG3)Similar to CaERG3Similar to CaERG3Complete0.5Slightly higher
C. neoformans (CnERG3)Similar to CaERG3Similar to CaERG3Complete1.0Substantially higher
R. delemar A (RdERG3A)Very lowStrongly reducedNo>64N/A
R. delemar B (RdERG3B)Similar to CaERG3Similar to CaERG3Complete0.5Similar to CaERG3
A. fumigatus A (AfERG3A)Lower than CaERG3ReducedPartial4-8High
A. fumigatus B (AfERG3B)Similar to CaERG3Similar to CaERG3Complete1.0Similar to CnERG3
A. fumigatus C (AfERG3C)NoneNoneNo>64N/A

When expressed in a C. albicans erg3Δ/Δ mutant, CgERG3 demonstrates lower C-5 sterol desaturase activity compared to CaERG3, as evidenced by reduced ergosterol content and elevated levels of ergosta-7,22-dienol and episterol . This suggests potential differences in catalytic efficiency or substrate specificity between these homologs.

Interestingly, CgERG3 only partially restores the stress and hyphal growth defects of the C. albicans erg3Δ/Δ mutant, further indicating functional differences between the C. glabrata and C. albicans enzymes .

What mechanisms explain the species-specific differences in ERG3 contribution to azole sensitivity?

The species-specific differences in how ERG3 homologs contribute to azole sensitivity can be explained through several mechanisms:

These mechanistic differences highlight the importance of studying ERG3 function across different fungal pathogens to better understand and potentially exploit species-specific vulnerabilities in antifungal drug development.

How do ERG3 mutations affect fitness costs in C. glabrata?

ERG3 mutations in C. glabrata are associated with fitness costs that can be measured through various experimental approaches:

  • In vitro competition assays: When anidulafungin-resistant C. glabrata strains with ERG3 mutations compete against strains without such mutations in the absence of the drug, the ERG3 mutants show a competitive disadvantage . This indicates a fitness cost associated with these mutations under normal growth conditions.

  • In vivo competition assays: Similar fitness costs are observed in Galleria mellonella infection models, where ERG3 mutant strains are outcompeted by non-mutant strains in the absence of antifungal pressure .

  • Stress response alterations: Some ERG3 mutations may be associated with altered responses to membrane stressors (SDS) and oxidative stress (H₂O₂), though these effects appear to be context-dependent and may vary based on the specific mutation and genetic background .

  • Selective advantage under drug pressure: Critically, when competition experiments are performed in the presence of antifungal drugs, the fitness cost is reversed, and ERG3 mutant strains outcompete non-mutant strains . This demonstrates the adaptive value of these mutations despite their fitness costs in drug-free environments.

The moderate fitness costs associated with ERG3 mutations may explain why these mutations are readily selected in clinical settings where antifungal pressure is present but may revert when drug pressure is removed.

What is the temporal relationship between ERG3 mutations and other resistance-conferring mutations in C. glabrata?

The temporal relationship between ERG3 mutations and other resistance-conferring mutations (particularly FKS mutations conferring echinocandin resistance) in C. glabrata provides insights into adaptive trajectories:

Analysis of intermediate generations during experimental evolution of C. glabrata in the presence of anidulafungin reveals variable patterns:

  • Equal precedence patterns: Among the cases studied, there were equal numbers of instances (2 each) where either ERG3 or FKS mutations appeared first, suggesting no consistent temporal relationship between these mutation types .

  • Simultaneous appearance: In 5 cases, both ERG3 and FKS mutations were traced to the same intermediate generation, indicating potential concurrent selection .

  • Mutational path diversity: The diversity in mutational patterns suggests multiple adaptive paths to antifungal resistance, with no single "optimal" sequence of mutation acquisition.

These findings have important implications for understanding the evolutionary dynamics of resistance acquisition in C. glabrata and may inform strategies to prevent or delay the emergence of resistant strains in clinical settings.

How can recombinant C. glabrata ERG3 be used to study structure-function relationships in sterol desaturases?

Recombinant C. glabrata ERG3 provides a valuable tool for studying structure-function relationships in sterol desaturases through several methodological approaches:

  • Heterologous expression systems: Expressing CgERG3 in C. albicans erg3Δ/Δ backgrounds allows researchers to isolate the function of this specific enzyme and study its properties without interference from the native enzyme .

  • Comparative functional analysis: By expressing CgERG3 alongside other fungal ERG3 homologs in the same genetic background, researchers can directly compare their functional properties, including:

    • Catalytic efficiency (measured by ergosterol content)

    • Substrate specificity

    • Propensity to produce toxic sterol intermediates

    • Contribution to antifungal sensitivity

  • Mutational analysis: Through site-directed mutagenesis of specific residues in CgERG3, researchers can identify:

    • Catalytic residues essential for desaturase activity

    • Determinants of substrate specificity

    • Structural elements contributing to protein stability

    • Residues involved in interaction with other pathway components

  • Domain swapping experiments: Creating chimeric proteins between CgERG3 and other fungal ERG3 proteins can help identify regions responsible for specific functional properties, such as the varying propensities to produce toxic diols upon azole exposure .

  • Correlation with structural models: Mapping mutations onto predicted structural models of CgERG3 can provide insights into how specific alterations affect enzyme function and contribute to resistance phenotypes.

These approaches collectively contribute to a deeper understanding of the structural basis of C-5 sterol desaturase function and may inform the design of novel antifungal agents targeting this enzyme or strategies to counter resistance.

What are the optimal conditions for expressing and assaying recombinant C. glabrata ERG3 activity?

To successfully express and assay recombinant C. glabrata ERG3 activity, researchers should consider the following methodological parameters:

  • Expression systems:

    • Heterologous yeast expression: C. albicans erg3Δ/Δ mutants provide an excellent background for functional analysis of CgERG3 .

    • Promoter selection: Strong constitutive promoters like TEF1 ensure high-level expression of the recombinant enzyme .

    • Vector design: Integration vectors or autonomously replicating plasmids with appropriate selectable markers can be used depending on the experimental goals.

  • Growth conditions:

    • Media composition: Rich media (YPD) or synthetic defined media with appropriate supplements.

    • Temperature: Standard 30°C for routine growth.

    • Growth phase: Late exponential to early stationary phase typically yields optimal sterol content for analysis.

  • Activity assays:

    • Sterol profile analysis: Gas chromatography-mass spectrometry (GC-MS) is the gold standard for quantifying ergosterol and intermediate sterols to assess desaturase activity .

    • Sample preparation: Typically involves alkaline hydrolysis of cells followed by extraction of non-saponifiable lipids using hexane or similar solvents.

    • Internal standards: Addition of cholesterol or other non-fungal sterols as internal standards enables quantitative analysis.

  • Functional validation assays:

    • Stress response tests: Exposure to various stressors (osmotic, oxidative, thermal) can reveal functional complementation of C. albicans erg3Δ/Δ phenotypes by CgERG3 .

    • Antifungal susceptibility testing: Standardized methods (CLSI or EUCAST) for determining MICs provide functional information about the expressed enzyme's contribution to drug sensitivity .

    • Growth curve analysis: Measuring growth kinetics in liquid media with or without antifungal agents provides quantitative data on the functional impact of the recombinant enzyme.

These methodological considerations ensure reliable expression and accurate assessment of recombinant C. glabrata ERG3 activity for research applications.

What experimental approaches can distinguish between different mechanisms of ERG3-mediated resistance?

Distinguishing between different mechanisms of ERG3-mediated resistance requires a multi-faceted experimental approach:

  • Sterol profile analysis:

    • Quantification of ergosterol content and pathway intermediates using GC-MS can differentiate between resistance mechanisms involving:

      • Complete loss of ERG3 function (absence of ergosterol, accumulation of ergosta-7,22-dienol)

      • Partial reduction in activity (reduced ergosterol levels)

      • Altered substrate specificity (novel sterol profiles)

  • Genetic complementation studies:

    • Introduction of wild-type ERG3 into resistant strains to determine if resistance is due to ERG3 loss-of-function

    • Site-directed mutagenesis to introduce specific mutations and assess their individual contributions to resistance

  • Transcriptional analysis:

    • RT-PCR or RNA-seq to determine if ERG3 expression is altered in resistant strains

    • Analysis of expression patterns of other ergosterol pathway genes that might compensate for ERG3 alterations

  • Phenotypic characterization:

    • Assessment of cross-resistance patterns to different antifungal classes

    • Evaluation of the "petite" phenotype (mitochondrial dysfunction) which can be ruled out by confirming absence of mtDNA deletions and growth on non-fermentable carbon sources

    • Stress response profiling to identify specific vulnerabilities associated with different resistance mechanisms

  • Combination drug studies:

    • Testing combinations of azoles with other agents that target different aspects of sterol metabolism

    • Evaluating synthetic interactions between drugs can reveal mechanistic insights

Through these complementary approaches, researchers can distinguish between various mechanisms of ERG3-mediated resistance, including loss of function, altered substrate specificity, or indirect effects on sterol metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.