Recombinant Candida glabrata Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Production of Recombinant COX2 Protein

The production of recombinant C. glabrata COX2 represents a significant biotechnological achievement that has facilitated detailed studies of this protein without requiring cultivation of the pathogenic organism. Commercial suppliers like CUSABIO offer partial recombinant C. glabrata COX2 protein (Product Code: CSB-BP015073CZI1) with high purity levels (>85% by SDS-PAGE) . These recombinant proteins are typically produced using baculovirus expression systems, which allow for proper post-translational modifications that may be critical for protein function and structural integrity . The recombinant protein is derived from the reference strain Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65), ensuring consistency and reproducibility in research applications .

Proper storage and handling of recombinant COX2 are crucial for maintaining its stability and activity. The shelf life is typically 6 months for liquid preparations stored at -20°C/-80°C, while lyophilized forms maintain stability for approximately 12 months at the same temperature range . For reconstitution, manufacturers recommend using deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL, followed by the addition of glycerol (typically to a final concentration of 50%) for long-term storage . Importantly, repeated freezing and thawing should be avoided to prevent protein degradation, with working aliquots ideally stored at 4°C for up to one week .

The production of high-quality recombinant COX2 faces several technical challenges. As a mitochondrial protein normally synthesized within the organelle, ensuring proper folding and functionality when expressed in heterologous systems requires careful optimization. Additionally, the hydrophobic nature of membrane proteins like COX2 can complicate expression, purification, and solubilization processes. Researchers have developed various strategies to overcome these challenges, including the use of specialized detergents, fusion tags, and expression hosts optimized for membrane protein production.

For scientific applications requiring validated protein products, commercial recombinant COX2 preparations undergo rigorous quality control testing. These assessments typically include verification of protein identity by mass spectrometry, purity evaluation via SDS-PAGE, functional assays, and stability testing . The tag type used for purification is often determined during the manufacturing process to optimize protein yield and activity, with different tags potentially affecting protein solubility and functionality .

Applications in Molecular Typing and Epidemiology

The sequence diversity of the COX2 gene makes it an excellent marker for molecular typing of C. glabrata clinical isolates. Research has demonstrated that COX2 sequence analysis enables strain differentiation based on the 13 identified haplotypes, providing a valuable tool for epidemiological investigations and outbreak tracking . This approach offers advantages over traditional phenotypic methods, providing higher resolution and reproducibility for strain identification. The ability to differentiate between closely related strains is particularly valuable in healthcare settings, where understanding transmission patterns can inform infection control strategies.

Notably, certain polymorphisms in the COX2 gene correlate with geographical origins of isolates. Specifically, nucleotide positions 51 and 519 appear to discriminate between strains isolated in the United States and those from Brazil, suggesting potential utility as geographical markers . This geographical specificity aligns with broader observations about the population structure of C. glabrata, which exhibits clonal expansion patterns with limited genetic exchange between different geographical clades . This genomic signature provides insights into the global dissemination patterns of C. glabrata and may help track the spread of virulent or drug-resistant strains.

The multilocus sequence typing (MLST) approach, which includes analysis of multiple genetic loci, has incorporated mitochondrial gene sequences like COX2 to enhance discriminatory power . While MLST methods using solely nuclear genes can identify major clades of C. glabrata, the addition of mitochondrial markers allows for finer resolution within these groups. This combined approach is particularly valuable for detailed epidemiological investigations that require discrimination between closely related strains within the same geographical region.

Table 2: Applications of COX2 in C. glabrata Research

ApplicationKey FindingsResearch Significance
Strain Typing13 haplotypes identified based on 17 substitution sitesEnables tracking of clinical isolates for epidemiological studies
Geographical MarkersPositions 51 and 519 differentiate US vs. Brazil strainsAssists in tracking global transmission patterns
Evolutionary Studies11.4% sequence divergence rate per 10^8 yearsProvides chronological framework for understanding pathogen evolution
Population StructureSupports clonal population model with limited genetic exchangeHelps understand adaptation and spread of pathogenic traits
Complementary to MLSTEnhances discrimination when combined with nuclear markersImproves resolution for closely related strains
Mitochondrial DysfunctionLinks to azole resistance mechanismsProvides insights into antifungal resistance development

Role of COX2 in Antifungal Resistance and Pathogenesis

The mitochondrial location of COX2 places it at the intersection of energy metabolism and stress response pathways that influence C. glabrata pathogenesis and drug resistance. Research has established connections between mitochondrial function and azole resistance in C. glabrata. Cells with mitochondrial DNA deficiency (petite mutants) upregulate ATP binding cassette (ABC) transporter genes, including CgCDR1, CgCDR2, and CgSNQ2, resulting in increased resistance to azole antifungals . Although these petite mutants exhibit growth deficiencies in vitro, they can demonstrate enhanced virulence and fitness in murine infection models compared to their azole-susceptible, respiration-competent parents .

One significant clinical case involved sequential C. glabrata isolates recovered from a patient undergoing azole therapy. The first isolate (BPY40) was azole-susceptible (fluconazole MIC, 4 μg/ml), while the second isolate (BPY41) exhibited high azole resistance (fluconazole MIC, >256 μg/ml) . The resistant isolate demonstrated mitochondrial dysfunction and upregulation of ABC transporter genes, consistent with the petite phenotype . Transcriptomic analysis revealed significant changes in oxidative metabolism and stress response pathways in the resistant isolate, along with upregulation of genes involved in cell wall remodeling, potentially explaining its enhanced virulence despite respiratory deficiency .

Recent research has also begun to uncover the regulatory networks governing mitochondrial function and drug resistance in C. glabrata. Transcription factors like CgRpn4 have been identified as determinants of azole drug resistance, regulating the expression of numerous genes including those involved in ergosterol biosynthesis . While direct regulation of COX2 by these transcription factors has not been established, the interconnected nature of mitochondrial function and stress response pathways suggests potential regulatory relationships that warrant further investigation.

Recent Advances and Future Research Directions

Recent technological advances have expanded our understanding of C. glabrata biology and opened new avenues for COX2-related research. The advent of CRISPR-Cas9 gene editing tools adapted for C. glabrata has facilitated more precise genetic manipulation, enabling researchers to investigate the functional consequences of specific COX2 mutations. These approaches complement traditional gene knockout methods and allow for more nuanced studies of structure-function relationships within the cytochrome c oxidase complex.

Advances in protein structure determination techniques, including cryo-electron microscopy, are providing unprecedented insights into the three-dimensional organization of respiratory complexes. While the complete structure of C. glabrata cytochrome c oxidase has not yet been determined at high resolution, structural information from related organisms is informing models of COX2 function and potential inhibitor binding sites. The availability of recombinant protein facilitates such structural studies by providing sufficient quantities of purified material for crystallization and other biophysical analyses.

The discovery of new regulatory pathways in C. glabrata is revealing complex interconnections between mitochondrial function, drug resistance, and virulence. For example, research has identified a novel protein in C. glabrata (CgYhi1) that is regulated by mating signaling pathways despite the organism's predominantly asexual reproduction mode . While not directly related to COX2 function, such findings illustrate the repurposing of conserved signaling pathways for novel functions in C. glabrata, which may include regulation of mitochondrial genes under specific conditions.

Transcriptomic and proteomic approaches are increasingly being applied to understand the global response of C. glabrata to environmental stresses, including antifungal exposure. These studies provide context for understanding the role of mitochondrial proteins like COX2 within broader cellular adaptations. For instance, RNA sequencing during fluconazole exposure has revealed that the transcription factor CgRpn4 regulates numerous genes involved in proteasome function and ergosterol biosynthesis . Similar approaches can potentially identify factors influencing COX2 expression and function under different stress conditions.

The clinical significance of mitochondrial function in C. glabrata infections continues to be an active area of research. The isolation of petite mutants from patients receiving antifungal therapy highlights the relevance of mitochondrial dysfunction in clinical settings . Future studies may focus on developing diagnostic methods to detect such variants and tailoring treatment approaches accordingly. Additionally, the potential for targeting mitochondrial functions as an antifungal strategy represents an intriguing avenue for therapeutic development.

Table 3: Future Research Priorities for C. glabrata COX2

Research AreaCurrent Knowledge GapsPotential Approaches
Structural BiologyHigh-resolution structure of C. glabrata COX2Cryo-EM, X-ray crystallography with recombinant protein
Regulatory NetworksFactors controlling COX2 expressionChIP-seq, transcriptomics under various conditions
Clinical RelevancePrevalence of COX2 mutations in clinical settingsSequencing of isolates from treatment failures
Therapeutic TargetingPotential for COX2-specific inhibitorsStructure-based drug design, screening approaches
Evolutionary AdaptationsSelection pressures on COX2 during infectionLongitudinal sequencing of isolates during treatment
Interspecies InteractionsRole in mixed Candida infectionsCo-culture systems, animal models of polymicrobial infection

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
COX2
Target Protein Sequence
MLNLLNTLFLNVISNDVPTPYGIYFQDSATPNQEGILELHDNIMFYLFIILGLVSWMLFT IVKTYSKNPMAYKYIKHGQTIEIIWTMFPAVILLIIAFPSFILLYLCDEVISPAMTIKAI GYQWYWKYEYSDFINDNGETIEFESYVIPDDLLEEGQLRLLDTDTSVVVPVDTHIRFVVT GADVIHDFAIPSLGIKVDANPGRLNQVSALIQREGVFYGQCSELCGVNHAAMPIKIEAVS LPKFLEWLNEQ
Uniprot No.

Target Background

Function
Recombinant *Candida glabrata* Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation and comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center (subunit 2) and heme A (subunit 1) to the binuclear center (BNC) in subunit 1, comprising heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Candida glabrata Cytochrome c oxidase subunit 2 (COX2) and how does it differ from human COX2?

Candida glabrata COX2 is a mitochondrion-encoded gene that codes for the second subunit of the cytochrome c oxidase complex, which is essential for cellular respiration. Unlike human COX2 (also known as PTGS2), which is involved in inflammation and is the target of NSAID drugs, C. glabrata COX2 is primarily used in research for intraspecific typing of strains due to its relatively rapid evolutionary rate. The complete coding region spans approximately 756 bp, making it an ideal target for amplification and sequencing studies . Human COX2, in contrast, has been extensively studied as a cancer biomarker and therapeutic target involved in prostaglandin production and tissue inflammation .

Why is mitochondrial COX2 preferred for typing C. glabrata strains compared to nuclear genes?

Mitochondrial genes like COX2 evolve much faster than nuclear genes, which typically exhibit very limited intraspecific variation. This accelerated evolutionary rate makes mitochondrial COX2 particularly suitable for investigating close phylogenetic relationships and discriminating intraspecific variants. Research has estimated the average evolutionary rate of COX2 to be approximately 11.4% sequence divergence per 108 years, allowing for the differentiation of strains that would appear identical when analyzed with more conserved nuclear markers . This property enables researchers to perform fine-scale typing of clinical isolates, which is crucial for epidemiological investigations and understanding pathogen transmission patterns.

What is the evolutionary significance of the C. glabrata COX2 gene?

The COX2 gene serves as an important phylogenetic marker for understanding evolutionary relationships among yeast species. Phylogenetic analyses based on COX2 sequences have shown consistency with relationships derived from ribosomal RNA sequence data, providing complementary evidence for yeast taxonomy . Moreover, the gene contains sufficient variation to distinguish between closely related strains, with studies identifying 13 distinct haplotypes among clinical isolates. This molecular clock function makes COX2 valuable for estimating divergence times between different species and isolates, which helps researchers understand how C. glabrata populations have evolved and spread globally.

What are the recommended primers and PCR conditions for amplifying the C. glabrata COX2 gene?

For amplification of the complete C. glabrata COX2 coding region, researchers have successfully used the following primers:

  • Forward primer COF: 5′-ATGTTAAATTTATTATATAA-3′

  • Reverse primer COR: 5′-TTATTGTTCGTTTAATCATTC-3′

These primers were designed based on the published sequence (GenBank accession no. X69430) and successfully amplify a 750-bp fragment from total cellular DNA of C. glabrata strains . It's important to note that these primers show high specificity for C. glabrata and do not amplify COX2 from related species such as Saccharomyces cerevisiae or Candida albicans due to sequence divergence in the N-terminus region of the COX2 protein, which corresponds to the forward primer binding site. This specificity makes them valuable for selective amplification in mixed samples.

How can researchers distinguish between mitochondrial COX2 and potential nuclear pseudogenes?

To ensure that amplified COX2 sequences represent the expressed mitochondrial gene rather than nuclear pseudogenes, researchers should employ RNA-based verification methods. A recommended approach involves:

  • Isolation of mitochondrial polyadenylated RNA

  • Conversion to cDNA using oligo(dT) primers (due to polyadenylation of mitochondrial transcripts)

  • PCR amplification from the cDNA using COX2-specific primers

  • Inclusion of appropriate controls, such as mock reverse transcription reactions without the reverse transcriptase enzyme

This methodology confirms that amplified fragments are reverse transcriptase-dependent and therefore derived from RNA rather than contaminating DNA. Sequence comparison between products amplified from total cellular DNA and those from mitochondrial cDNA can verify that they represent the same expressed mitochondrial gene . This is essential for accurate typing and phylogenetic analyses, as nuclear pseudogenes evolve under different selective pressures.

What sequencing strategies ensure accurate COX2 sequence data for strain typing?

To ensure high-quality sequence data for COX2-based strain typing, researchers should implement the following rigorous approaches:

  • Sequencing both DNA strands in duplicate to minimize sequencing artifacts

  • Performing independent PCR amplifications to exclude potential Taq DNA polymerase errors

  • Direct sequencing of PCR products to identify potential heteroplasmy (mixed mitochondrial genomes)

  • Including known reference strains (such as ATCC strains) as internal controls

  • Confirming critical polymorphic sites through targeted resequencing

This comprehensive approach minimizes errors that could lead to misclassification of strains. It's particularly important when identifying novel haplotypes or when using sequence data for epidemiological investigations where accuracy is paramount . Researchers should also be aware that in some cases, direct sequencing of PCR products may be preferable to cloning before sequencing to avoid introducing biases during the cloning process.

How does COX2 sequence analysis enable typing of C. glabrata clinical isolates?

COX2 sequence analysis provides a powerful approach to typing C. glabrata isolates through direct sequence comparisons rather than profile-based methods like RAPD or RFLP, which are subject to systematic errors due to non-independence of characters. The method relies on identifying polymorphisms across the 756-bp coding region. In one comprehensive study, 16 of 756 (2.1%) positions were found to be variable, enabling the identification of 13 different haplotypes .

The typing process involves:

  • Amplification and sequencing of the complete COX2 coding region

  • Alignment with reference sequences

  • Identification of key polymorphic positions (both synonymous and nonsynonymous)

  • Classification into haplotypes based on substitution patterns

  • Phylogenetic analysis to determine relationships between isolates

This sequence-based approach offers higher resolution and reproducibility compared to traditional typing methods, making it valuable for epidemiological investigations and outbreak monitoring.

What key polymorphic positions in COX2 are most informative for geographical differentiation of C. glabrata strains?

Research has identified specific polymorphic sites in the COX2 gene that correlate with the geographical origin of C. glabrata isolates. The most informative positions are 51 and 519, which contain synonymous substitutions that differentiate strains into two major types:

PositionType 1 (U.S. predominant)Type 2 (Brazil predominant)
51TC
519CT

These polymorphisms show strong geographical correlation, with approximately 82% of Brazilian isolates belonging to type 2 and 90% of U.S. isolates belonging to type 1 . This geographical distinction provides valuable information for tracking strain movement and understanding global population structure. Exceptions to this pattern (Brazilian strains with type 1 COX2 or U.S. strains with type 2 COX2) might indicate relatively recent migratory events, offering insights into pathogen transmission across geographical boundaries.

How can COX2 sequence data be applied in epidemiological investigations of C. glabrata infections?

COX2 sequence data provides valuable information for epidemiological investigations by enabling researchers to:

  • Determine whether infections in different patients originated from a single source or multiple sources

  • Track nosocomial outbreaks by establishing genetic relationships between isolates

  • Monitor the introduction and spread of specific strains in healthcare settings

  • Estimate divergence times between isolates to establish transmission timelines

  • Identify geographical sources of infection based on type-specific polymorphisms

The divergence times calculated from COX2 sequence differences can provide estimates of how likely it is that different patients acquired C. glabrata from single or different sources, which is critical for implementing effective infection control measures . Additionally, the identification of specific haplotypes could potentially be correlated with virulence traits or antifungal susceptibility patterns, though more research is needed in this area.

What is the significance of the frameshift mutation at position 673 in C. glabrata COX2?

One of the most intriguing features of C. glabrata COX2 is a frameshift mutation (C insertion at position 673) that has been observed in multiple clinical isolates but is absent in the reference strain CBS 138 and in Saccharomyces cerevisiae. This frameshift occurs near the 3' end of the coding region and would theoretically result in a truncated protein lacking the copper-binding domain essential for Cox2 function .

Despite this apparent defect, strains with this frameshift mutation show normal growth under aerobic conditions, suggesting that functional Cox2 protein is still produced. This observation implies the existence of suppressor mechanisms such as:

  • Suppressor tRNAs that may compensate for the frameshift

  • RNA polymerase slippage during transcription

  • Translational frameshifting during protein synthesis

This phenomenon is not unprecedented, as mitochondrial gene frameshift mutations and corresponding suppressor mechanisms have been previously described in yeast mitochondria. The presence of this frameshift in the majority of clinical isolates but not in CBS 138 suggests that C. glabrata strains may be divided into two groups: those more closely related to S. cerevisiae (without the frameshift) and those more distantly related (with the frameshift) . This provides an important evolutionary marker for understanding C. glabrata population structure.

How do nonsynonymous changes in COX2 affect protein function in C. glabrata?

Sequence analysis of C. glabrata COX2 has identified several nonsynonymous substitutions among different strains. Importantly, none of these nonsynonymous changes affect amino acid residues that are essential for the correct structure and function of the Cox2 peptide, including the copper-binding domain which encompasses two histidines and two cysteines in the carboxy-terminal end .

This conservation of functionally critical residues across strains suggests that there is strong selective pressure to maintain Cox2 function, which is essential for aerobic respiration. The nonsynonymous substitutions that do occur are likely located in regions of the protein that can tolerate amino acid changes without compromising function. This pattern of variation—where functionally important residues are conserved while others are free to vary—is typical of genes under purifying selection and provides insight into the structural and functional constraints on the Cox2 protein.

How can the estimated evolutionary rate of COX2 (11.4% sequence divergence/108 years) be applied in molecular clock analyses?

The relatively rapid evolutionary rate of COX2 (11.4% sequence divergence per 108 years) makes it an excellent marker for molecular clock analyses, particularly for recent evolutionary events. This rate was determined by comparing COX2 sequences with 18S ribosomal DNA (small-subunit rRNA gene) sequences and calibrating against known divergence times . Researchers can apply this evolutionary rate to:

  • Estimate divergence times between different C. glabrata strains

  • Calculate how recently different geographical populations have been separated

  • Determine the timing of evolutionary events such as selective sweeps or population bottlenecks

  • Establish a timeline for the emergence of specific traits such as drug resistance

The formula T = K/2r can be used, where T is the divergence time, K is the corrected phylogenetic distance for COX2, and r is the evolutionary rate (11.4% per 108 years). This approach allows researchers to place C. glabrata evolution in a temporal context, providing valuable insights into the history and spread of this pathogenic yeast .

What are the challenges in distinguishing C. glabrata COX2 from COX2 homologs in other Candida species?

Distinguishing C. glabrata COX2 from homologs in other Candida species presents several challenges:

  • Sequence divergence in the N-terminus region, which necessitates species-specific primers

  • Potential cross-reactivity in mixed infections containing multiple Candida species

  • The existence of closely related cryptic species that may have similar COX2 sequences

  • Possible horizontal gene transfer events between closely related yeast species

Researchers have addressed these challenges by designing highly specific primers that target regions of sequence divergence. For example, the primers COF and COR specifically amplify C. glabrata COX2 but do not amplify the gene from S. cerevisiae or C. albicans due to sequence differences . For comprehensive species differentiation, it may be necessary to combine COX2 analysis with other genetic markers. Future research should focus on developing multiplex PCR approaches that can simultaneously identify multiple Candida species in clinical samples.

How might post-translational modifications affect COX2 function in C. glabrata compared to other species?

While the search results don't specifically address post-translational modifications (PTMs) of COX2 in C. glabrata, research on human COX2 has shown that PTMs such as S-nitrosylation can significantly impact protein function and localization. For example, human studies have identified distinct forms of COX2—S-nitrosylated and non-nitrosylated—that occupy different subcellular locations and potentially have distinct functions .

By analogy, C. glabrata COX2 may undergo similar modifications that affect:

  • Protein stability and turnover

  • Subcellular localization and trafficking

  • Interaction with other components of the respiratory chain

  • Enzymatic activity and efficiency

Research into potential PTMs of C. glabrata COX2 represents an important future direction. Techniques such as mass spectrometry-based proteomics could be employed to identify specific modifications and their sites. Understanding these modifications might provide insights into the functional adaptation of C. glabrata to different environmental conditions, including the host environment during infection.

What implications do COX2 variations have for antifungal resistance and virulence in C. glabrata?

While direct connections between COX2 variations and antifungal resistance or virulence have not been explicitly established in the search results, several theoretical implications can be considered:

Future research should investigate potential correlations between specific COX2 haplotypes and clinically relevant phenotypes such as antifungal susceptibility patterns, biofilm formation capacity, and virulence in animal models. Such studies could determine whether COX2 typing has predictive value for clinical outcomes in C. glabrata infections . This could potentially lead to more personalized treatment approaches based on molecular typing of infecting strains.

What bioinformatic approaches are recommended for phylogenetic analysis of COX2 sequences?

For robust phylogenetic analysis of COX2 sequences, researchers should employ a combination of bioinformatic approaches:

Analysis StepRecommended Methods
Sequence AlignmentMultiple sequence alignment using MUSCLE or MAFFT algorithms
Substitution Model SelectionTesting various models (e.g., Kimura 2-parameter) to find best fit using AIC or BIC criteria
Tree ConstructionMaximum Likelihood, Bayesian Inference, and Neighbor-Joining methods
Statistical SupportBootstrap analysis (>1000 replicates) or posterior probabilities
Molecular Clock AnalysisCalibrated using the established evolutionary rate of 11.4% divergence/10^8 years

When analyzing COX2 sequences, it's important to consider both synonymous and nonsynonymous substitutions separately, as they evolve under different selective pressures. The Kimura 2-parameter model has been successfully applied to COX2 sequence analysis in previous studies . For divergence time calculations, researchers can use the expression T = KCOX2/2rCOX2, where T is the divergence time, KCOX2 is the corrected phylogenetic distance for COX2, and rCOX2 is the evolutionary rate.

How can researchers integrate COX2 typing data with other molecular markers for comprehensive strain characterization?

For comprehensive strain characterization, COX2 typing data should be integrated with other molecular markers through a multi-faceted approach:

  • Hierarchical Classification Scheme:

    • Use COX2 for fine-scale typing within clades

    • Employ more conserved markers (e.g., rDNA ITS regions) for higher-level grouping

    • Integrate whole genome SNP data when available for maximum resolution

  • Concatenated Sequence Analysis:

    • Combine aligned sequences from multiple loci (COX2, rDNA, housekeeping genes)

    • Perform partitioned analyses that apply appropriate evolutionary models to each gene region

    • Generate combined phylogenies with stronger statistical support

  • Correlation Analysis:

    • Assess congruence between typing methods using statistical approaches

    • Identify discordant patterns that might indicate horizontal gene transfer or hybridization

    • Use clustering algorithms to identify naturally occurring strain groups

This integrated approach provides a more complete picture of strain relationships than any single marker alone, improving the reliability of epidemiological investigations and evolutionary studies . The combination of mitochondrial markers like COX2 with nuclear markers can also help distinguish between cytoplasmic and nuclear inheritance patterns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.