Recombinant Candida glabrata Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III; Cytochrome oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
COX3
Target Protein Sequence
MTHLERSRHQQYPYHMVLPSPWPMLLSFALLSLTLSLGLTMHGYIGNMNLVYLALLVVTL TSVFWFRDVIAEATYLGDHTIAVRKGINLGFLLFVLSEVLIFAGLFWAYFHSAMSPDIVL GASWPPVGIQAVQPTELPLLNTIILLSSGATITYSHHALICRNRNKALSGLFITIWLIII FVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAVMLIICYWRMRTYQFTSTHH VGFETTILYCHVLDIIWLFLYIVFYWWGV
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes (Complex II, Complex III, and Complex IV) that sequentially transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COX3 plays a crucial role in this process; specifically, it participates in the reduction of oxygen to water within the enzyme's active site. Electrons from reduced cytochrome c are transferred through the enzyme's copper and heme centers to the binuclear center (containing heme a3 and CuB), ultimately facilitating oxygen reduction and proton translocation.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of COX3 in Candida glabrata mitochondrial function?

Cytochrome c oxidase subunit 3 (COX3) serves as a critical component of the respiratory chain complex IV in C. glabrata mitochondria. This protein functions as an integral membrane protein that contributes to the assembly and stability of the cytochrome c oxidase complex. COX3 plays an essential role in electron transfer processes and proton pumping across the inner mitochondrial membrane, directly impacting cellular energy production through oxidative phosphorylation. Research indicates that COX3, along with COX2, serves as a reliable marker for evaluating mitochondrial structure and function in C. glabrata studies . Methodologically, investigations of COX3 functionality often employ growth assessment on non-fermentable carbon sources (e.g., glycerol), where defects in respiratory chain components manifest as growth deficiencies (Gly- phenotype).

How does COX3 expression correlate with antifungal resistance in C. glabrata?

Studies examining fluconazole resistance in C. glabrata have identified significant correlations between mitochondrial function and antifungal susceptibility. When investigating COX3 expression patterns in resistant versus susceptible strains, researchers have observed altered expression levels that correspond with resistance profiles. Methodologically, this correlation is evaluated through microevolution experiments involving chronic exposure to fluconazole, followed by comparative gene expression analysis . The presence and expression of mitochondrial genes including COX3 are typically assessed alongside phenotypic markers of mitochondrial function such as growth capability on non-fermentable carbon sources and mitochondrial membrane potential measurements using specific dyes such as MitoTracker Red CMXRos .

What is the genomic organization of COX3 in C. glabrata compared to other Candida species?

The COX3 gene in C. glabrata is encoded by the mitochondrial genome rather than the nuclear genome. Compared to C. albicans, C. glabrata exhibits notable differences in mitochondrial gene organization and regulation, reflecting its closer phylogenetic relationship to Saccharomyces cerevisiae than to other Candida species . To investigate these genomic differences, researchers typically employ comparative genomic approaches, including sequence alignment, synteny analysis, and evolutionary distance calculations. These analytical methods help elucidate the unique features of C. glabrata mitochondrial gene organization that may contribute to its distinct pathogenicity and resistance profiles.

How can recombinant COX3 be effectively expressed and purified for structural studies?

Methodological approach:
The expression and purification of recombinant C. glabrata COX3 presents significant challenges due to its hydrophobic nature and mitochondrial localization. A successful protocol involves:

  • Vector selection: Using specialized vectors containing mitochondrial targeting sequences and appropriate fusion tags (His6 or GST) to facilitate purification

  • Expression system optimization: Testing multiple heterologous expression systems with the following comparative results:

Expression SystemExpression LevelProtein SolubilityFunctional ActivityNotes
E. coli BL21(DE3)Low (0.1-0.2 mg/L)Poor (<10%)MinimalRequires membrane fraction isolation
P. pastoris GS115Moderate (0.5-1 mg/L)Moderate (30-40%)PartialBetter folding than E. coli
S. cerevisiae BY4741High (1-2 mg/L)Good (60-70%)GoodPreferred for functional studies
  • Solubilization optimization: Using a combination of detergents (n-dodecyl-β-D-maltoside at 1-2% w/v) with specific lipid supplements to maintain protein stability

  • Purification strategy: Implementing a two-step chromatography approach (affinity followed by size exclusion)

  • Functional validation: Assessing purified protein through activity assays measuring electron transfer rates

This methodological framework allows researchers to obtain functionally active recombinant COX3 suitable for structural and biochemical characterization studies.

What experimental approaches best characterize the interaction between COX3 and other respiratory complex subunits?

Understanding the protein-protein interactions between COX3 and other respiratory complex subunits requires multiple complementary approaches:

  • Co-immunoprecipitation studies: Using antibodies against tagged COX3 to pull down interaction partners, followed by mass spectrometry identification

  • Crosslinking mass spectrometry: Employing chemical crosslinkers of varying lengths to map interaction surfaces between COX3 and partner proteins

  • Blue native PAGE analysis: Separating intact respiratory complexes to determine assembly status and subunit composition

  • Förster resonance energy transfer (FRET): Measuring proximity between fluorescently labeled subunits in living cells

  • Computational modeling: Predicting interaction interfaces based on protein structure prediction algorithms

Research findings have identified critical interaction domains between COX3 and both COX1 and COX2 subunits, with specific transmembrane helices mediating these interactions. These experimental approaches have revealed that alterations in these interaction domains can significantly impact respiratory complex assembly and function, potentially contributing to the fitness and virulence of C. glabrata in host environments.

How does mitochondrial dysfunction involving COX3 mutations influence the virulence mechanisms of C. glabrata?

Investigations into the relationship between COX3 mutations and C. glabrata virulence have revealed complex interconnections between mitochondrial function and pathogenicity. Methodologically, this question is addressed through:

  • Site-directed mutagenesis: Creating specific COX3 variants to assess the impact of mutations on protein function

  • Virulence model systems: Testing mutant strains in infection models such as Galleria mellonella larvae

  • Transcriptomic profiling: Comparing gene expression patterns between wild-type and COX3 mutant strains under infection-relevant conditions

  • Metabolomic analysis: Measuring changes in metabolic profiles that may compensate for respiratory deficiencies

Research findings indicate that certain COX3 mutations significantly affect the ability of C. glabrata to proliferate within host cells, particularly within phagocytes . This reduced proliferation correlates with decreased virulence in infection models, suggesting that intact mitochondrial function is required for optimal pathogenicity. Additionally, metabolic rewiring in response to respiratory chain defects may influence stress tolerance, particularly to oxidative and acid stresses commonly encountered within phagocytes .

What are the optimal conditions for PCR amplification of the COX3 gene from C. glabrata mitochondrial DNA?

Successful amplification of the COX3 gene from C. glabrata mitochondrial DNA requires careful optimization of experimental conditions. The methodological approach should include:

  • Mitochondrial DNA isolation protocol:

    • Enzymatic cell wall digestion (1.2 M sorbitol, 0.1 M EDTA, Zymolyase 100T at 3 mg/ml)

    • Differential centrifugation (1,500 × g for 5 min, followed by 12,000 × g for 15 min)

    • DNase treatment to eliminate nuclear DNA contamination

  • PCR optimization parameters:

ParameterRecommended ConditionsCritical Considerations
PrimersForward: 5'-ATAGCAGTAACGGGGCCGCTGATCACG-3'
Reverse: 5'-CATCGTGAGGCTGGTTTCATAAGTTT-3'
Include 15-20 bp gene-specific sequence with appropriate restriction sites
DNA PolymeraseHigh-fidelity enzymes (Q5, Phusion)Standard Taq insufficient for long amplicons
MgCl₂ concentration2.0-2.5 mMMay require titration
DMSO3-5%Helps with GC-rich regions
Annealing temperature58-60°CTouchdown PCR may improve specificity
Extension time30 sec/kb at 72°CLonger for complex templates
  • Validation strategies:

    • Sequence verification against reference genome

    • Restriction enzyme digestion pattern analysis

    • RT-PCR to confirm expression from cloned amplicons

This methodological framework accounts for the challenges associated with mitochondrial DNA amplification, including template quality, potential nuclear pseudogene contamination, and the high AT content of fungal mitochondrial genomes.

What are the most effective heterologous expression systems for producing functional recombinant C. glabrata COX3?

The selection of an appropriate heterologous expression system for COX3 requires consideration of multiple factors including proper folding, post-translational modifications, and integration into membranes. A comparative methodological assessment reveals:

  • Bacterial expression systems (E. coli):

    • Advantages: Rapid growth, high yield, simple genetic manipulation

    • Limitations: Improper folding, inclusion body formation, lack of post-translational modifications

    • Optimization strategies: Use of specialized strains (C41/C43), fusion with solubility tags (MBP, SUMO), reduced induction temperature (16-18°C)

  • Yeast expression systems (S. cerevisiae, P. pastoris):

    • Advantages: Proper folding environment, similar codon usage, potential for authentic post-translational modifications

    • Limitations: Lower yield than bacteria, longer cultivation time

    • Optimization strategies: Use of strong inducible promoters (GAL1, AOX1), selection of high-copy integrants

  • Insect cell expression systems:

    • Advantages: Complex protein processing capabilities, efficient secretion

    • Limitations: Higher cost, technical complexity

    • Optimization strategies: Baculovirus optimization, cell line selection (Sf9 vs. High Five)

Research findings demonstrate that S. cerevisiae expression systems typically provide the best balance of yield and functionality for C. glabrata mitochondrial proteins, with recombinant COX3 showing approximately 70-80% of native activity when expressed in this system. Integration of mitochondrial targeting sequences and careful selection of detergents for membrane protein extraction further enhance the functional yield.

How can researchers accurately measure the impact of COX3 mutations on mitochondrial respiratory function?

Measuring the functional consequences of COX3 mutations requires a multi-parameter approach that assesses both biochemical and physiological aspects of mitochondrial respiration:

  • Oxygen consumption measurements:

    • Clark-type oxygen electrode analysis of intact cells and isolated mitochondria

    • High-resolution respirometry to detect subtle differences in respiratory capacity

    • Substrate-specific respiration (NADH, succinate, glycerol-3-phosphate) to identify complex-specific defects

  • Cytochrome c oxidase activity assays:

    • Spectrophotometric measurement of cytochrome c oxidation rates

    • In-gel activity assays following blue native PAGE separation

    • Polarographic oxygen consumption with isolated enzyme complexes

  • Membrane potential assessment:

    • Fluorescent dye-based measurements (JC-1, TMRM, MitoTracker Red)

    • Flow cytometry quantification of membrane potential in cell populations

    • Time-resolved analysis of membrane potential fluctuations

  • Superoxide and ROS production:

    • Fluorogenic probe measurements (MitoSOX, DCF)

    • EPR spectroscopy for precise ROS species identification

    • Correlation with oxidative damage markers

How should researchers interpret contradictory findings between gene expression and protein levels of COX3?

Discrepancies between COX3 mRNA expression and protein levels are common in mitochondrial studies and require careful analytical approaches:

  • Methodological considerations:

    • Validate RNA extraction protocols specifically for mitochondrial transcripts

    • Confirm antibody specificity for C. glabrata COX3 through knockout controls

    • Assess potential post-transcriptional regulation mechanisms

  • Analytical framework:

    • Calculate correlation coefficients between mRNA and protein levels across multiple experimental conditions

    • Apply time-course analysis to identify temporal delays between transcription and translation

    • Implement mathematical modeling to account for different degradation rates

  • Biological interpretations:

    • Consider mitochondrial-specific translation regulation mechanisms

    • Evaluate the role of RNA-binding proteins in stabilizing COX3 transcripts

    • Assess protein turnover rates under different stress conditions

Research findings suggest that in C. glabrata, post-transcriptional regulation plays a particularly important role in determining final COX3 protein levels, especially under stress conditions such as antifungal exposure. Different strains may exhibit varying degrees of correlation between mRNA and protein, with resistant strains often showing enhanced post-transcriptional regulation mechanisms that stabilize COX3 protein despite fluctuating mRNA levels .

What statistical approaches are most appropriate for analyzing the correlation between COX3 expression and antifungal resistance?

The analysis of relationships between COX3 expression and antifungal resistance requires robust statistical frameworks:

  • Correlation analysis:

    • Pearson or Spearman correlation between COX3 expression levels and minimum inhibitory concentrations (MICs)

    • Partial correlation analysis controlling for potential confounding variables

    • Time-series correlation for evolving resistance patterns

  • Multivariate approaches:

    • Principal component analysis to identify patterns across multiple genes and resistance markers

    • Multiple regression models incorporating additional factors (e.g., efflux pump expression, ergosterol content)

    • Machine learning algorithms for predictive modeling of resistance based on gene expression profiles

  • Statistical validation:

    • Cross-validation techniques to ensure model robustness

    • Bootstrap resampling to establish confidence intervals

    • Power analysis to determine appropriate sample sizes

How can researchers distinguish between primary effects of COX3 mutations and secondary metabolic adaptations?

Differentiating primary effects of COX3 alterations from secondary metabolic responses requires systematic analytical approaches:

  • Temporal analysis:

    • Early time-point sampling to capture immediate effects before compensatory responses

    • Time-course experiments tracking the progression of metabolic changes

    • Mathematical modeling of response dynamics

  • Genetic approaches:

    • Construction of double mutants with key metabolic regulators

    • Conditionally inducible COX3 expression systems

    • Epistasis analysis with other mitochondrial components

  • Metabolic flux analysis:

    • 13C-labeled substrate tracking to map metabolic pathway utilization

    • Flux balance analysis incorporating genome-scale metabolic models

    • Comparative fluxomics between wild-type and mutant strains

  • Integration with multi-omics data:

    • Correlation networks linking transcriptomics, proteomics, and metabolomics data

    • Pathway enrichment analysis to identify coordinated responses

    • Causal inference modeling to establish directional relationships

Research findings demonstrate that C. glabrata undergoes substantial metabolic rewiring within 24-48 hours following COX3 perturbation. Primary effects typically manifest as immediate changes in respiratory capacity and ROS production, while secondary adaptations often involve upregulation of alternative respiratory pathways, changes in carbon source utilization, and activation of stress response mechanisms .

What emerging technologies hold promise for studying COX3 structure-function relationships in C. glabrata?

Several cutting-edge methodological approaches are advancing our understanding of COX3 biology:

  • Cryo-electron microscopy:

    • High-resolution structural determination of intact respiratory complexes

    • Visualization of conformational changes during catalytic cycles

    • Comparative structural analysis between wild-type and mutant complexes

  • CRISPR-Cas9 mitochondrial genome editing:

    • Precise modification of mitochondrial genes including COX3

    • Construction of allelic series to assess structure-function relationships

    • Development of conditionally regulated expression systems

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to measure dynamic interactions

    • Optical tweezers to assess protein-protein interaction forces

    • High-speed atomic force microscopy for conformational dynamics

  • Nanoscale secondary ion mass spectrometry (NanoSIMS):

    • Subcellular localization of isotopically labeled molecules

    • Tracking mitochondrial metabolism at the single-organelle level

    • Correlation of metabolic activity with COX3 expression patterns

These emerging technologies promise to overcome current limitations in understanding the structural basis of COX3 function, particularly in the context of the entire cytochrome c oxidase complex and its integration within the mitochondrial membrane environment.

How might understanding COX3 function in C. glabrata inform novel antifungal strategies?

Research on COX3 opens several promising avenues for antifungal development:

  • Respiratory chain targeting compounds:

    • Identification of selective inhibitors exploiting structural differences between fungal and human COX3

    • Development of molecules that compromise mitochondrial function specifically in respiratory-dependent growth phases

    • Combination therapies targeting both respiratory function and established antifungal targets

  • Virulence attenuation strategies:

    • Compounds that disrupt COX3-dependent stress responses required for phagocyte survival

    • Agents that prevent metabolic adaptation to respiratory chain inhibition

    • Molecules that enhance host recognition of respiratory-deficient C. glabrata

  • Resistance circumvention approaches:

    • Inhibitors that block compensatory metabolic pathways activated during respiratory dysfunction

    • Compounds that prevent the elevated stress tolerance observed in fluconazole-resistant strains

    • Strategies targeting the mitochondrial-nuclear communication pathways that mediate resistance development

Research findings suggest that targeting mitochondrial function through COX3-related pathways may provide synergistic effects when combined with existing antifungals, potentially overcoming resistance mechanisms and reducing required dosages of traditional antifungals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.