Recombinant Candida glabrata Golgi apparatus membrane protein TVP18 (TVP18)

Shipped with Ice Packs
In Stock

Description

Biological Role and Functional Insights

TVP18 is part of a network of Tvp proteins (Tvp15, Tvp23, Tvp38) that interact with Yip1-family proteins (Yip4, Yip5) to maintain Golgi/endosomal function . Key findings include:

  • Localization: Primarily resides in Tlg2-containing late Golgi/endosomal compartments .

  • Genetic Interactions:

    • Synthetic aggravation with ypt6 or ric1 mutations, suggesting roles in retrograde Golgi trafficking .

    • Nonessential for growth under laboratory conditions but critical under stress .

  • Vesicular Trafficking: Co-purifies with Rab GTPases (e.g., Ypt31/32) and vSNAREs (e.g., Gos1), implicating it in secretory pathway regulation .

Research Applications

Recombinant TVP18 is utilized for:

  1. Structural Studies: Mapping transmembrane domains and protein-protein interaction interfaces .

  2. Functional Assays: Investigating Golgi-endosomal dynamics in fungal pathogens .

  3. Drug Target Exploration: Linked to calcineurin signaling pathways, which mitigate vesicular trafficking stresses caused by antifungals like micafungin .

Comparative Analysis Across Species

TVP18 homologs exhibit conserved roles:

SpeciesProtein NameFunctionReference
S. cerevisiaeTVP18Late Golgi/endosomal maintenance
C. glabrataTVP18Vesicular trafficking, stress response
Aspergillus clavatusTVP18Putative clathrin-coated vesicle protein

Significance in Pathogenicity and Therapeutics

While TVP18 itself is not a direct virulence factor, its interaction network influences fungal adaptability:

  • Antifungal Resistance: Calcineurin-dependent stress responses involving TVP18 may aid survival under drug-induced ER/Golgi stress .

  • Evolutionary Conservation: Homologs in pathogenic fungi (e.g., Candida albicans) highlight its broader role in fungal biology .

Key Research Gaps

  • Mechanistic Details: How TVP18 collaborates with Yip proteins for compartment maintenance remains unclear .

  • Clinical Relevance: Direct links to C. glabrata pathogenicity or host interaction are underexplored .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order remarks. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
TVP18; CAGL0K03025g; Golgi apparatus membrane protein TVP18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
TVP18
Target Protein Sequence
MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGI VQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLL VLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVVREML
Uniprot No.

Target Background

Function
TVP18 is a Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP18 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How does TVP18 differ structurally from other membrane proteins in Candida species?

TVP18 has distinctive structural characteristics compared to other membrane proteins in Candida species. Analysis of its 167-amino acid sequence reveals multiple transmembrane domains with predominantly hydrophobic amino acid residues, typical of Golgi membrane proteins . Unlike plasma membrane proteins such as β-(1,3)-glucan synthase (GS) and Pma1 that form distinct microdomains at the cell surface, TVP18 localizes specifically to the Golgi apparatus membrane .

The protein does not possess the AXVXH pentapeptide motif found in other Candida proteins like Yhi1, which is involved in inter-species communication . Instead, TVP18's structure is optimized for intracellular vesicular transport functions. Its N-terminal region can be successfully tagged with His-tag without disrupting function, suggesting this region is not critical for protein activity .

What expression systems are most effective for producing recombinant TVP18?

Escherichia coli has been demonstrated as an effective heterologous expression system for the production of recombinant TVP18. The full-length protein (1-167 amino acids) has been successfully expressed in E. coli with an N-terminal His-tag, yielding protein preparations with greater than 90% purity as determined by SDS-PAGE .

When expressing TVP18 in E. coli, several considerations are important:

  • Codon optimization for E. coli may improve expression efficiency

  • Growth conditions should be optimized (temperature, induction time, inducer concentration)

  • Purification via His-tag affinity chromatography yields high purity preparations

  • Final preparations can be lyophilized for long-term storage

Alternative expression systems, including yeast-based systems like Pichia pastoris, might offer advantages for proper folding of this eukaryotic membrane protein, though these approaches would require different optimization parameters than the documented E. coli system .

What are the optimal storage and handling conditions for recombinant TVP18?

Recombinant TVP18 requires specific handling and storage conditions to maintain structural integrity and functionality. The protein is typically supplied as a lyophilized powder that requires careful reconstitution. Based on established protocols, the following conditions are recommended :

  • Reconstitution procedure:

    • Brief centrifugation of the vial before opening

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of glycerol to a final concentration of 5-50% (50% is standard)

  • Storage guidelines:

    • Long-term storage: -20°C to -80°C in aliquots containing glycerol

    • Working aliquots: 4°C for up to one week

    • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

  • Stability considerations:

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • Working aliquots should be prepared in volumes appropriate for single experiments

Compared to other Candida membrane proteins, TVP18 exhibits moderate stability but requires careful handling to prevent aggregation common to hydrophobic membrane proteins .

How can researchers distinguish between native and recombinant TVP18 in experimental settings?

Distinguishing between native and recombinant TVP18 in experimental settings requires multiple analytical approaches:

  • Western blot analysis:

    • Recombinant TVP18 with His-tag shows increased molecular weight (~2-3 kDa higher) compared to native protein

    • Anti-His antibodies specifically detect recombinant protein but not native TVP18

    • Anti-TVP18 antibodies detect both forms, allowing comparative analysis

  • Mass spectrometry analysis:

    • Peptide mass fingerprinting can identify tag-specific peptides in recombinant protein

    • Native protein from C. glabrata crude membrane preparations shows distinct peptide patterns

    • Approximately 74% of the predicted C. glabrata proteome can be identified in crude membrane preparations, allowing comprehensive analysis

  • Functional assays:

    • Comparison of activities between native and recombinant forms can reveal functional differences

    • Trafficking assays using fluorescent markers can assess functional equivalence

PropertyNative TVP18Recombinant His-tagged TVP18
Molecular Weight~19 kDa~21-22 kDa
Antibody DetectionAnti-TVP18 onlyAnti-TVP18 and Anti-His
LocalizationGolgi apparatusDepends on experimental system
SolubilityRequires detergentEnhanced by His-tag

What methods are most reliable for assessing TVP18 function in vitro and in vivo?

Assessing TVP18 function requires complementary approaches that address both in vitro biochemical properties and in vivo cellular roles:

In vitro functional assessment:

  • Liposome reconstitution assays:

    • Purified recombinant TVP18 can be incorporated into artificial liposomes

    • Vesicle trafficking can be measured using fluorescent lipid analogs

    • Protein-protein interaction assays with other Golgi components can reveal binding partners

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm proper secondary structure

    • Limited proteolysis to assess folding quality compared to predicted domains

    • Thermal stability assays to determine protein robustness

In vivo functional assessment:

  • Fluorescent protein tagging:

    • N-terminal YFP or GFP tagging allows visualization of cellular localization

    • Live-cell imaging can track protein movement and dynamics

    • Similar approaches have been used successfully with other C. glabrata membrane proteins

  • Gene deletion and complementation:

    • Knockout strains assess phenotypic consequences of TVP18 absence

    • Complementation with wild-type or mutant variants can map functional domains

    • Heterologous expression in other yeast species can test functional conservation

  • Interaction mapping:

    • Proximity labeling approaches (BioID, APEX) can identify neighboring proteins

    • Co-immunoprecipitation with tagged TVP18 can identify stable binding partners

    • Comparative analysis with other vesicular trafficking proteins can situate TVP18 in the cellular machinery

How does TVP18 function compare to homologous proteins in other Candida species?

TVP18 functions within a complex network of Golgi trafficking proteins that exhibit varying degrees of conservation across Candida species. Comparative analysis reveals both conserved and species-specific aspects:

Cross-species complementation experiments, where the TVP18 gene from one species replaces the native gene in another, could determine the degree of functional interchangeability between homologs and identify species-specific adaptations in protein function.

What role might TVP18 play in Candida glabrata pathogenicity and drug resistance?

While direct evidence linking TVP18 to pathogenicity is limited, several lines of reasoning suggest potential roles in virulence and drug resistance:

  • Golgi trafficking and virulence factor secretion:
    Proper Golgi function is essential for the secretion of various virulence factors in pathogenic fungi. Disruption of TVP18 could potentially alter the secretion of adhesins, hydrolytic enzymes, and other virulence-associated proteins required for host colonization.

  • Cell wall integrity maintenance:
    The Golgi apparatus plays a crucial role in the biosynthesis and trafficking of cell wall components. Given that cell wall remodeling is important for both pathogenicity and drug resistance, TVP18 may indirectly influence these processes by ensuring proper delivery of cell wall biosynthetic enzymes .

  • Stress response pathways:
    Membrane trafficking proteins often participate in stress response pathways. TVP18 might contribute to C. glabrata's exceptional stress tolerance, which is associated with its pathogenicity and antifungal resistance.

  • Potential interaction with known pathogenicity mechanisms:
    C. glabrata employs various mechanisms for host colonization, including repurposing of conserved pathways for novel functions. For instance, the mating MAPK pathway regulates Yhi1 expression despite C. glabrata's predominantly asexual reproduction . Similar repurposing might apply to TVP18-mediated processes.

Research approaches to test these hypotheses might include virulence assessment of TVP18 knockout mutants in infection models and transcriptomic analysis to identify conditions that alter TVP18 expression during infection or drug exposure.

How does membrane environment affect TVP18 structure and function?

The lipid composition and biophysical properties of the Golgi membrane significantly influence TVP18 structure and function:

  • Lipid microenvironment effects:
    Golgi membranes contain distinct lipid compositions that differ from plasma membranes, including intermediate levels of sterols and specific sphingolipids. These lipids create a specific environment that may be crucial for proper TVP18 folding and function. Research in other membrane proteins has shown that disrupting membrane composition can alter protein function even without direct protein modification .

  • Membrane domain formation:
    Recent research on C. glabrata plasma membrane proteins has revealed heterogeneous distribution into distinct microdomains . Similarly, TVP18 may localize to specific Golgi membrane domains with unique lipid compositions that facilitate its function in vesicular trafficking.

  • Experimental approaches to study membrane effects:

    • Reconstitution of purified TVP18 into artificial liposomes with defined lipid compositions

    • Fluorescence correlation spectroscopy to assess protein mobility in different membrane environments

    • Lipid modification through genetic or pharmacological means to assess effects on TVP18 localization and function

  • Antifungal implications:
    Echinocandins like caspofungin alter plasma membrane structures and protein distributions in C. glabrata . Similarly, other antifungals targeting ergosterol biosynthesis might indirectly affect TVP18 function by disrupting Golgi membrane composition, potentially contributing to drug efficacy or resistance mechanisms.

What are the key considerations when designing experiments to study TVP18 interactions with other proteins?

Designing experiments to study TVP18 protein interactions requires careful methodological considerations:

  • Protein-protein interaction detection methods:

    • Co-immunoprecipitation with tagged TVP18 requires optimization of detergent conditions to maintain membrane protein interactions

    • Proximity labeling approaches like BioID or APEX2 can identify transient interactions in the native cellular environment

    • Split-reporter assays (BiFC, SRET) can visualize interactions in living cells

  • Experimental controls and validation:

    • Negative controls should include structurally similar but functionally distinct Golgi membrane proteins

    • Validation of interactions through multiple independent methods is essential

    • Functional assays should assess the biological relevance of identified interactions

  • Experimental design considerations:

    • Expression levels must be carefully controlled to avoid artifacts from overexpression

    • Temporal dynamics of interactions may be critical for vesicular trafficking proteins

    • Comparison of interactions in different growth conditions may reveal context-dependent interactions

  • Data analysis approach:
    When analyzing multiple protein interactions or performing time-series studies, appropriate statistical approaches are required. Simple change in raw score or percentage change analysis may not be appropriate for complex designs with multiple variables . Advanced statistical methods like ANCOVA may be necessary to account for covariates that influence the experimental outcome.

How can researchers accurately quantify changes in TVP18 expression under different experimental conditions?

Accurate quantification of TVP18 expression requires consideration of multiple factors to ensure reliable and reproducible results:

  • mRNA-level quantification:

    • RT-qPCR with properly validated reference genes specific to C. glabrata

    • RNA-seq for genome-wide expression analysis with appropriate normalization

    • Consideration of post-transcriptional regulation that may affect correlation between mRNA and protein levels

  • Protein-level quantification:

    • Western blotting with carefully validated antibodies against TVP18 or epitope tags

    • Mass spectrometry-based quantification using labeled reference peptides

    • Flow cytometry if using fluorescent protein fusions in living cells

  • Experimental design considerations:

    • Multiple biological and technical replicates are essential

    • Time-course experiments can reveal dynamic expression patterns

    • Appropriate controls for each experimental condition

  • Normalization strategies:

    Quantification MethodRecommended Normalization ApproachLimitations
    RT-qPCRMultiple reference genes validated for stability under experimental conditionsMay not reflect post-transcriptional regulation
    Western BlotTotal protein normalization or multiple housekeeping proteinsLimited dynamic range
    Mass SpectrometryLabeled reference peptides or global normalization approachesRequires specialized equipment
    Flow CytometryInternal fluorescence standardsLimited to tagged proteins in living cells
  • Statistical analysis:
    For complex experimental designs, particularly those with multiple post-test measurements, standard statistical approaches may be insufficient. Consultation with a statistician is recommended for longitudinal studies with multiple variables .

What are the critical parameters for optimizing purification of functional recombinant TVP18?

Purifying functional TVP18 presents significant challenges due to its hydrophobic nature and membrane localization. The following parameters are critical for successful purification:

  • Solubilization conditions:

    • Detergent selection is crucial: mild non-ionic detergents (DDM, LMNG) often preserve membrane protein structure

    • Detergent concentration must be optimized to prevent protein aggregation while minimizing excessive delipidation

    • Buffer composition (pH, ionic strength, stabilizing additives) significantly impacts protein stability

  • Purification strategy:

    • Affinity chromatography using His-tag is effective for initial capture

    • Secondary purification steps (ion exchange, size exclusion) improve purity

    • On-column detergent exchange can improve protein stability

    • Consider amphipol or nanodisc reconstitution for long-term stability

  • Quality control assessments:

    • Size-exclusion chromatography to verify monodispersity

    • Dynamic light scattering to detect aggregation

    • Functional assays to confirm biological activity

    • Circular dichroism to assess secondary structure integrity

  • Optimization parameters:

    ParameterRange to TestMonitoring Method
    Detergent TypeDDM, LMNG, OG, DigitoninProtein yield, monodispersity
    Detergent Concentration1-5× CMCExtraction efficiency, protein stability
    Salt Concentration100-500 mM NaClProtein solubility, aggregation prevention
    pH6.5-8.5Protein stability, yield
    Temperature4°C, 18°C, 25°CExtraction efficiency vs. stability
    AdditivesGlycerol, cholesterol, specific lipidsFunctional preservation
  • Storage considerations:
    For long-term storage, lyophilization with 6% trehalose in a Tris/PBS-based buffer at pH 8.0 has been successfully used . For working aliquots, storage at 4°C for up to one week is possible, but repeated freeze-thaw cycles should be avoided.

What are the most promising future research directions for TVP18?

Several high-potential research directions for TVP18 warrant further investigation:

  • Structural characterization:
    Determining the high-resolution structure of TVP18 using cryo-electron microscopy or X-ray crystallography would provide invaluable insights into its function and potential as a drug target. Recent advances in membrane protein structural biology make this increasingly feasible.

  • Functional genomics:
    Comprehensive studies combining TVP18 knockout/mutation with transcriptomic and proteomic analyses could reveal the broader cellular impact of TVP18 dysfunction and identify compensatory mechanisms.

  • Role in pathogenesis:
    Investigating potential roles of TVP18 in C. glabrata virulence, particularly in mixed-species infections with C. albicans, could reveal unknown aspects of fungal pathogenesis. Unlike Yhi1, which directly mediates C. glabrata-C. albicans interactions , TVP18 may have indirect but significant effects on virulence through its role in cellular trafficking.

  • Comparative analysis:
    Systematic comparison of TVP18 function across different Candida species could reveal species-specific adaptations and potential vulnerabilities that could be exploited for species-specific antifungal development.

  • Drug target potential: Evaluation of TVP18 as a potential antifungal target, particularly by screening for compounds that disrupt its function or localization, could lead to novel therapeutic approaches for C. glabrata infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.