Recombinant Candida glabrata Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
GET2; CAGL0J03366g; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
GET2
Target Protein Sequence
MSLSEAEKRKILRERRQQKFSRGGASERLNKIVGGQGSQLDTKSALDEKPEVVEEIPREA VKPEMNSSVQAKKESTAQAKAEDPQVELFRQLAEMQGQGATESTPDLFSMMKNLGATGDS PFPMAEQQVEAIDPELVEYHKYRVNTLTAKTTLVKWIVLLAYIFLLTRTDDTYFPFVVRS YLPEVFTSQSSFFSIFLTFEILATSIYYQLSVGVERETGVKTLQDTSKIVSLVSMVPEGI LPIADLRGKVILAMKYWNIIAMMIGDVCFVLVAIGLVSQI
Uniprot No.

Target Background

Function

Recombinant Candida glabrata Golgi to ER traffic protein 2 (GET2) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). GET2, in conjunction with GET1, functions as a membrane receptor for soluble GET3. GET3 specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the function of GET2 in Candida glabrata?

GET2 (Golgi to ER traffic protein 2) is a critical component of the GET complex in Candida glabrata, functioning alongside GET1 and GET3. The primary role of this complex is to mediate the insertion of tail-anchored (TA) proteins into the endoplasmic reticulum membrane. GET1 and GET2 form a membrane receptor complex on the ER that specifically recruits GET3, which delivers TA proteins from the cytosol to the ER membrane. This process is essential for proper protein trafficking and secretory pathway function. In C. glabrata, disruption of GET2 can lead to defects in retrograde Golgi to ER trafficking, with pronounced Kar2 secretion phenotypes indicative of ER stress response activation .

How do I properly store and handle recombinant C. glabrata GET2 protein?

Recombinant C. glabrata GET2 protein should be stored at -20°C or -80°C for extended storage. For working stocks, aliquot the protein and store at 4°C for up to one week to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity. For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add glycerol to a final concentration of 50% and store in aliquots at -20°C/-80°C . The appropriate buffer for storage is typically a Tris-based buffer with 50% glycerol, optimized for this specific protein .

What experimental approaches can be used to study GET2 function in C. glabrata?

To study GET2 function in C. glabrata, several methodological approaches have proven effective:

  • CRISPR-Cas9 Gene Editing: Utilize the CRISPR-Cas9 system for precise gene disruption. This approach involves:

    • Designing sgRNAs targeting the GET2 locus using bioinformatics tools like CASTING

    • Expressing Cas9 under appropriate promoters (either C. glabrata native promoters like pCYC1 or heterologous promoters like pTEF1 from S. cerevisiae)

    • Confirming mutations using Surveyor assay and sequencing

  • Localization Studies: Employ fluorescent protein tagging (GFP/RFP) to visualize GET2 and its interaction partners, examining colocalization patterns in both wild-type and mutant backgrounds .

  • Protein-Protein Interaction Analysis: Implement techniques such as:

    • Yeast two-hybrid (Y2H) screening to identify GET2 interacting partners

    • Co-immunoprecipitation to confirm physical interactions

    • In vitro binding assays with microsomes and proteoliposomes containing GET complex components

  • Phenotypic Assays: Assess the impact of GET2 deletion through:

    • Kar2 secretion assays to measure ER-Golgi trafficking defects

    • Growth rate experiments in various media conditions

    • Microscopy to observe cellular morphology changes

How can I generate GET2 knockout strains in C. glabrata?

Generating GET2 knockout strains in C. glabrata can be efficiently accomplished using the CRISPR-Cas9 system, which has been optimized for this pathogenic yeast. The process involves:

  • Selection of an appropriate parental strain: Typically, a ∆HTL (his3∆/trp1∆/leu2∆) auxotrophic background is used to facilitate plasmid selection.

  • Design of targeting components:

    • Create a plasmid expressing Cas9 under either a C. glabrata endogenous promoter (pCYC1) or a S. cerevisiae heterologous promoter (pTEF1)

    • Design sgRNAs targeting GET2 using specialized tools like CASTING that optimize guide efficiency for C. glabrata genome

  • Transformation strategy:

    • For NHEJ-mediated disruption: Transform both Cas9 and sgRNA expressing plasmids

    • For homology-directed repair: Include a repair template with selection marker

  • Confirmation methods:

    • Surveyor assay to detect indels

    • PCR amplification and sequencing of the target locus

    • Phenotypic verification by assessing Kar2 secretion or other GET2-associated phenotypes

  • Strain validation:

    • Growth rate analysis compared to wild-type

    • Western blot to confirm absence of GET2 protein

    • Complementation tests to verify phenotype specificity

When implementing this approach, efficiency rates of 70-80% for generating indels at the GET2 locus have been reported when both components are expressed from their optimal promoters .

What role does GET2 play in C. glabrata pathogenicity?

The connection between GET2 and C. glabrata pathogenicity involves several mechanistic aspects:

  • Protein Trafficking Impact: GET2 disruption affects proper targeting of tail-anchored proteins, including SNAREs like Sed5, which are critical for vesicular trafficking. This perturbation can alter the secretion of virulence factors and cell wall components essential for host-pathogen interactions .

  • Stress Response Modulation: The GET complex influences ER stress responses, which are crucial for adaptation to host environments. Deletion of GET2 leads to constitutive activation of ER stress pathways, potentially altering the fungal cell's ability to respond to host defense mechanisms .

  • Host Model Evidence: Though not directly tested for GET2, disruption of related GET complex components in C. glabrata has shown reduced virulence in Drosophila melanogaster infection models. The ∆HTL + CAS9 strains used for GET manipulation maintained normal growth rates within the host fly despite showing growth defects in vitro, suggesting complex environment-dependent effects .

  • Interaction with Host Factors: GET2's role in maintaining proper membrane protein topology may influence recognition by host immune components, though this requires further investigation in mammalian infection models .

While direct evidence specifically linking GET2 to virulence is still emerging, its fundamental role in membrane protein targeting suggests it could impact multiple virulence-associated pathways. Research using infection models combined with transcriptomic and proteomic analyses would provide more definitive insights into GET2's contribution to pathogenicity .

How does C. glabrata GET2 compare to homologs in other yeast species?

The GET system shows interesting evolutionary conservation and divergence across yeast species:

SpeciesGET2 Essential?Notable FeaturesFunctional Differences
C. glabrataNoPart of the GET complex with Get1/Get3Functions in TA protein insertion
S. cerevisiaeNoAlso known as Rmd7/Hur2More redundancy due to gene duplication
Y. lipolyticaUnknownPart of SRP-dependent pathwaySRP is essential unlike in S. cerevisiae
S. pombeUnknownPart of SRP-dependent pathwaySRP is essential unlike in S. cerevisiae
C. albicansUnknownPresent but less characterizedLikely similar to C. glabrata function

The GET complex has evolved with species-specific adaptations while maintaining its core function in tail-anchored protein insertion. In S. cerevisiae, there appears to be more redundancy in the secretory pathway due to gene duplication events, while in Y. lipolytica and S. pombe, the signal recognition particle (SRP) pathway is essential, unlike in S. cerevisiae and likely C. glabrata .

The preference for co-translational versus post-translational translocation pathways varies between species. In S. cerevisiae, the hydrophobicity of the N-terminal signal peptide influences SRP binding, while in Y. lipolytica, both the amino acid composition and conformation of the signal peptide determine SRP interaction . These differences may influence the relative importance of GET2 in each organism's secretory pathway.

What are the key techniques for expressing and purifying recombinant C. glabrata GET2?

Successful expression and purification of recombinant C. glabrata GET2 requires addressing the challenges associated with membrane protein production:

  • Expression System Selection:

    • E. coli has been successfully used to express His-tagged full-length GET2 (amino acids 1-280)

    • BL21(DE3) or similar strains with tightly controlled induction systems are preferred

    • For studies requiring post-translational modifications, yeast expression systems may be more appropriate

  • Construct Design Considerations:

    • N-terminal His-tag appears most effective for purification while maintaining function

    • Including a TEV protease cleavage site can facilitate tag removal post-purification

    • Codon optimization for the expression host improves yield

  • Solubilization and Purification Strategy:

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using mild detergents (DDM, LMNG, or Triton X-100)

    • IMAC purification using Ni-NTA or similar matrices

    • Size exclusion chromatography for final polishing

  • Quality Control Assessment:

    • SDS-PAGE with Coomassie staining showing >90% purity

    • Western blot confirmation with anti-His antibodies

    • Mass spectrometry for identity verification

    • Circular dichroism to confirm proper folding

  • Storage and Stability:

    • Lyophilization in Tris-based buffer with 6% trehalose at pH 8.0

    • Storage at -20°C/-80°C

    • Reconstitution in deionized water to 0.1-1.0 mg/mL

    • Addition of 50% glycerol for long-term storage

When properly expressed and purified, recombinant GET2 can be used for structural studies, interaction assays with other GET complex components, and in vitro reconstitution of TA protein insertion.

How do mutations in GET2 affect the entire GET complex functionality?

Mutations in GET2 can have diverse effects on the GET complex functionality through several mechanisms:

  • Receptor Formation Disruption: Since Get1 and Get2 form a heteromeric membrane receptor complex for Get3, mutations in GET2 can disrupt this receptor formation. The absence of GET2 leads to cytosolic mislocalization of Get3 and formation of cytosolic detergent-insoluble aggregates, indicating that GET2 is crucial for proper GET3 membrane localization .

  • Substrate Processing Impairment: The GET complex mediates insertion of tail-anchored proteins like the SNARE Sed5. When GET2 is mutated or deleted, these substrates remain in the cytosol or form aggregates, leading to defects in membrane trafficking. Specifically, decreased Sed5 SNARE activity in Golgi-ER traffic has been linked to Kar2 secretion phenotypes observed in GET mutants .

  • Pathway Compensation Analysis: In the absence of functional GET2, the cell attempts to use alternative pathways for TA protein insertion. Studies have shown that overexpression of Sed5 can suppress the Kar2 secretion defect in GET deletion strains, suggesting that increasing substrate concentration can force insertion through alternative, potentially spontaneous mechanisms .

  • Interaction Network Perturbation: GET2 mutations can disrupt interactions with other components of the secretory pathway. Genetic interaction maps have revealed that the GET complex functionally interfaces with multiple secretory pathway components, and perturbation of GET2 can have wide-ranging effects including mitochondrial dismorphogenesis, DNA replication defects, and V-type ATPase dysfunction .

These findings highlight that while GET2 has a specific role in TA protein insertion, its mutation affects multiple cellular processes due to the fundamental nature of proper membrane protein targeting in eukaryotic cells .

How can GET2 be targeted for antifungal development against C. glabrata?

The exploration of GET2 as a potential antifungal target presents several promising research directions:

  • Structural-Based Drug Design Approach:

    • Identify unique structural features of C. glabrata GET2 compared to human homologs

    • Focus on the GET1-GET2 interface or the GET2-GET3 interaction sites

    • Develop small molecules that specifically disrupt these fungal protein interactions

    • Use in silico docking studies to identify candidate compounds that bind to critical residues

  • Functional Inhibition Strategy:

    • Target the TA protein insertion mechanism unique to fungi

    • Develop peptide mimetics that compete with natural substrates

    • Design molecules that lock GET2 in a non-functional conformation

    • Create conditional expression systems to validate GET2 as an essential gene under infection-relevant conditions

  • Combination Therapy Potential:

    • Assess synergistic effects between GET2 inhibitors and existing antifungals

    • Explore whether GET2 disruption increases susceptibility to azoles or echinocandins

    • Determine if GET2 inhibition prevents development of resistance to other antifungals

  • Diagnostic Applications:

    • Develop GET2-based detection methods for rapid C. glabrata identification

    • Similar to existing RPA-LFS systems for other C. glabrata genes, develop specific detection for GET2 variants

    • Create assays that can detect drug-resistant strains based on GET2 expression patterns

The translational potential of this research would need validation through animal infection models and assessment of potential off-target effects on host GET pathway components to ensure therapeutic specificity .

What is the relationship between GET2 and other protein translocation pathways in C. glabrata?

The relationship between GET2 and other protein translocation pathways in C. glabrata reveals a complex network of overlapping and complementary systems:

  • Integration with SRP-Dependent Pathway:

    • GET2 primarily functions in post-translational insertion of TA proteins

    • This complements the SRP pathway that handles co-translational translocation

    • Unlike in Y. lipolytica and S. pombe where SRP is essential, C. glabrata likely resembles S. cerevisiae where both pathways can function independently

    • Certain proteins (like Kar2, Och1, and Ost1) can utilize either pathway, providing functional redundancy

  • Crosstalk with Sec61 Translocon Complex:

    • The GET complex and Sec61 translocon represent distinct membrane insertion mechanisms

    • Both ultimately facilitate protein integration into the ER membrane but through different mechanisms

    • While Sec61 forms a channel for most secretory and membrane proteins, the GET complex specializes in TA proteins

    • Some evidence suggests potential physical proximity or functional interaction at the ER membrane

  • Compensation Mechanisms:

    • When GET2 is absent, alternative pathways can partially compensate

    • Overexpression of substrate proteins (like Sed5) can force insertion through alternative routes

    • The SND (SRP-independent targeting) pathway may provide backup functionality

    • Heat shock proteins and chaperones may assist in TA protein handling when GET is compromised

  • Evolutionary Conservation Analysis:

    • Comparison across yeast species shows that while the GET pathway is conserved, its essentiality varies

    • The signal peptide properties (hydrophobicity, amino acid composition) determine pathway preference

    • C. glabrata appears to maintain flexibility in its translocation pathways, possibly contributing to its adaptability as a pathogen

This intricate relationship between translocation pathways may contribute to C. glabrata's resilience and adaptability in diverse host environments, making it a successful opportunistic pathogen .

How does GET2 expression change during C. glabrata infection and stress response?

Understanding GET2 expression dynamics during infection and stress conditions provides insights into its role in C. glabrata pathogenicity:

  • Host-Pathogen Interface Adaptation:

    • During early infection stages, GET2 expression may be upregulated to manage increased demand for membrane protein insertion as the pathogen adapts to the host environment

    • The proper localization of virulence factors, adhesins, and immune evasion proteins likely depends on functional GET complex activity

    • Recent studies with mating signaling pathway proteins in C. glabrata suggest that GET2 could be involved in similar regulatory networks that shape inter-species interactions

  • Stress Response Coordination:

    • Under ER stress conditions, GET2 expression patterns may change to accommodate increased protein folding demand

    • The proper insertion of TA proteins is crucial for managing ER stress through the unfolded protein response (UPR)

    • GET2 dysfunction leads to Kar2 secretion, indicating activation of ER stress response pathways

  • Antifungal Exposure Effects:

    • Exposure to azoles and other antifungals that disrupt membrane integrity may alter GET2 expression

    • The cell's need to remodel membrane composition during drug exposure likely requires adjusted GET complex activity

    • Potential compensatory upregulation of GET2 in response to perturbations in other membrane protein insertion pathways

  • Nutrient Limitation Response:

    • Under nutrient-limited conditions mimicking host environments, GET2 expression patterns may shift

    • The GET complex's role in managing protein trafficking during nutrient stress remains to be fully characterized

    • Comparison with other pathogenic Candida species could reveal species-specific adaptations in GET2 regulation

Experimental approaches to study these expression dynamics would include:

  • RNA-seq analysis during different infection phases

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors regulating GET2

  • Reporter constructs to visualize GET2 expression in real-time during host-pathogen interactions

What are common challenges in working with recombinant C. glabrata GET2 and how can they be overcome?

Working with recombinant C. glabrata GET2 presents several technical challenges due to its nature as a membrane protein. Here are common issues and their solutions:

  • Low Expression Yields:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for expression host, use strong inducible promoters, and consider fusion partners like MBP or SUMO that enhance solubility

    • Approach: Test expression in multiple strains (BL21(DE3), C41/C43, or Rosetta) at lower temperatures (16-20°C) with longer induction times

  • Protein Aggregation:

    • Problem: GET2 tends to form aggregates during expression and purification

    • Solution: Include detergents during cell lysis and throughout purification

    • Approach: Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations; include glycerol (10-20%) and reducing agents in all buffers

  • Protein Instability:

    • Problem: Purified GET2 loses activity during storage

    • Solution: Proper storage conditions are critical

    • Approach: Store in Tris-based buffer with 50% glycerol at -20°C/-80°C; avoid repeated freeze-thaw cycles; work with aliquots at 4°C for up to one week

  • Functional Verification Challenges:

    • Problem: Difficult to assess if recombinant GET2 retains native functionality

    • Solution: Develop appropriate functional assays

    • Approach: In vitro reconstitution with other GET complex components; binding assays with GET3; TA protein insertion assays with fluorescently labeled substrates

  • Contamination with Bacterial Proteins:

    • Problem: His-tagged GET2 co-purifies with bacterial proteins

    • Solution: Implement rigorous purification strategies

    • Approach: Use tandem affinity tags; include imidazole wash steps; add secondary purification methods like ion exchange or size exclusion chromatography

  • Reconstitution Difficulties:

    • Problem: Lyophilized protein may not fully reconstitute

    • Solution: Optimize reconstitution conditions

    • Approach: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL; use gentle agitation without vortexing; allow sufficient time for complete solubilization before use

By systematically addressing these challenges, researchers can obtain functional recombinant GET2 protein suitable for structural studies, interaction analyses, and functional characterization.

How can researchers evaluate GET2 function in different genetic backgrounds of C. glabrata?

Systematic evaluation of GET2 function across different genetic backgrounds provides insights into its contextual roles and potential strain-specific variations:

  • Strain Selection Strategy:

    • Include reference strains (ATCC 2001/CBS 138), clinical isolates, and laboratory-adapted strains

    • Select strains with varying degrees of virulence, drug resistance, and geographical origins

    • Consider genetic diversity at key loci related to secretory pathway function

  • Complementation Analysis Framework:

    • Generate GET2 deletion in multiple backgrounds using CRISPR-Cas9

    • Create complementation constructs with varying promoter strengths

    • Express GET2 variants from different strains in each genetic background

    • Analyze restoration of phenotypes (growth, Kar2 secretion, stress tolerance)

  • Phenotypic Characterization Methods:

    • Growth assays under various stressors (antifungals, temperature, pH, oxidative stress)

    • Microscopy to assess cellular morphology and organelle organization

    • ER stress reporter systems to measure UPR activation

    • Protein trafficking assays using model secretory proteins

  • Genetic Interaction Mapping:

    • Generate double mutants with other secretory pathway components

    • Perform synthetic genetic array (SGA) analysis if available for C. glabrata

    • Identify strain-specific genetic interactions through growth phenotypes

    • Use chemical-genetic profiling to uncover condition-specific effects

  • Molecular Characterization Approaches:

    • Sequence GET2 and associated genes across strains to identify polymorphisms

    • Perform RT-qPCR to measure expression levels in different backgrounds

    • Use ChIP-seq to characterize promoter binding and regulation

    • Implement proteomics to assess GET complex composition in different strains

Strain BackgroundGET2 Deletion PhenotypeComplementation EfficiencyKey Genetic Interactions
Reference (ATCC 2001)Growth defect, Kar2 secretionComplete with native GET2SND pathway components
Clinical isolate AVariable growth defectStrain-specific differencesStrain-specific interactions
Drug-resistant strainsPotential increased sensitivityMay require overexpressionPotential interactions with drug resistance mechanisms

This comprehensive approach allows researchers to distinguish between conserved and strain-specific aspects of GET2 function, providing insights into its evolutionary adaptation and role in pathogenicity .

What considerations are important when designing experiments to study GET2 interaction with tail-anchored proteins?

Designing robust experiments to study GET2 interactions with tail-anchored (TA) proteins requires careful consideration of several factors:

  • TA Protein Selection Criteria:

    • Choose biologically relevant TA proteins with established roles in C. glabrata

    • Include proteins with varying TMD hydrophobicity and C-terminal tail lengths

    • Select proteins from different cellular compartments (ER, Golgi, mitochondria)

    • Consider Sed5 as a primary model substrate based on established GET dependency

  • Interaction Detection Methods:

    • In vivo approaches:

      • Split-GFP or BiFC for visualizing interactions in living cells

      • Co-immunoprecipitation with appropriate controls for membrane proteins

      • Proximity labeling techniques (BioID, APEX) to identify transient interactions

      • Genetic suppressor screens to identify functional relationships

    • In vitro approaches:

      • Microscale thermophoresis for quantitative binding measurements

      • Surface plasmon resonance with reconstituted GET components

      • Crosslinking mass spectrometry to map interaction interfaces

      • Reconstituted proteoliposome systems to measure insertion kinetics

  • Controls and Validation:

    • Include known GET-dependent and GET-independent TA proteins as controls

    • Generate TMD mutants with altered hydrophobicity as specificity controls

    • Use GET3 binding mutants to distinguish direct vs. indirect effects

    • Implement domain swapping between different TA proteins to map specificity determinants

  • Data Analysis Considerations:

    • Quantify relative binding affinities across different TA proteins

    • Correlate binding strength with TMD properties (hydrophobicity, length, charge)

    • Compare GET2 interaction profiles between C. glabrata and other yeast species

    • Integrate structural information with functional data when available

  • Experimental Conditions:

    • Test interactions under different stress conditions relevant to infection

    • Examine effects of membrane composition on GET2-TA protein interactions

    • Consider temperature, pH, and ionic strength variations to mimic host environments

    • Assess effects of various detergents for in vitro studies to maintain native-like membrane environment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.