Recombinant Candida glabrata Mitochondrial dicarboxylate transporter (DIC1)

Shipped with Ice Packs
In Stock

Description

Functional Role of Mitochondrial Dicarboxylate Transporters

Mitochondrial dicarboxylate carriers transport intermediates like malate, oxaloacetate, and sulfate. In Saccharomyces cerevisiae, DIC1 (ScDIC1) is one of four dicarboxylate carriers, but its deletion (Δ DIC1) does not lead to observable growth defects under standard conditions . This contrasts with other mitochondrial carriers like Oac1p, which is critical for α-isopropylmalate (α-IPM) export in leucine biosynthesis .

Homology and Comparative Analysis

C. glabrata shares metabolic pathways with S. cerevisiae, including mitochondrial carrier proteins. Key findings:

  • Oac1p homologs: In S. cerevisiae, Oac1p transports α-IPM, oxaloacetate, and sulfate . Its deletion causes leucine auxotrophy, but Δ DIC1 does not .

  • CgDtr1: A C. glabrata multidrug transporter (CgDtr1) unrelated to DIC1 but implicated in virulence and stress resistance .

  • Mitochondrial carriers in Candida: C. glabrata mitochondrial function is linked to virulence through transcription factors like Tog1, which regulates oxidative phosphorylation and carnitine transport .

Recombinant DIC1 Expression and Characterization

While recombinant C. glabrata DIC1 is not explicitly described in the sources, methods for studying homologous transporters include:

  1. Heterologous expression: Overexpression in E. coli and reconstitution in liposomes, as done for ScOac1p .

  2. Transport assays: Measurement of substrate affinity (e.g., KmK_m values) using radiolabeled substrates .

  3. Genetic complementation: Testing growth rescue in transporter-deficient strains .

Research Gaps and Implications

  • Functional redundancy: Like ScDIC1, C. glabrata DIC1 may have overlapping roles with other carriers, masking phenotypic effects in single deletions .

  • Virulence linkage: Mitochondrial carriers in C. glabrata indirectly affect pathogenesis through oxidative stress responses or metabolite transport .

Key Data from Related Studies

ParameterS. cerevisiae DIC1S. cerevisiae Oac1pC. glabrata Tog1
SubstratesMalate, oxaloacetateα-IPM, oxaloacetate, sulfateCarnitine, TCA intermediates
Knockout phenotypeNo growth defect Leucine auxotrophy Reduced oxidative stress resistance
Role in virulenceNot studiedIndirect (via leucine biosynthesis) Direct (oxidative stress adaptation)

Future Directions

  • Structural studies: Cryo-EM or X-ray crystallography to resolve DIC1’s substrate-binding pockets.

  • Metabolic profiling: Isotope tracing to map dicarboxylate fluxes in Δ DIC1 strains.

  • Therapeutic targeting: Inhibitors of mitochondrial carriers (e.g., pentagalloyl glucose for CgCdr1 ) could inspire DIC1-focused antifungals.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing that specific tag.
Synonyms
DIC1; CAGL0G01166g; Mitochondrial dicarboxylate transporter; Dicarboxylate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
DIC1
Target Protein Sequence
MSEKQVKYPWWYGGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGL YAGLSASLLRQCTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFAD LINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVV TYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHD SSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKKYRVGMPKEEA
Uniprot No.

Target Background

Function
Mitochondrial dicarboxylic transporter responsible for the exchange of dicarboxylic acids, such as malate and succinate, for inorganic phosphate. This transporter is crucial for growth on ethanol and acetate.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of the mitochondrial dicarboxylate transporter (DIC1) in Candida glabrata?

The mitochondrial dicarboxylate transporter (DIC1) in C. glabrata primarily facilitates the transport of dicarboxylic acids, including malate, succinate, and fumarate, across the inner mitochondrial membrane. This transport function is essential for several metabolic processes, including:

  • The tricarboxylic acid (TCA) cycle, where it helps maintain metabolic flux by enabling substrate exchange

  • Mitochondrial redox balance by facilitating the transfer of reducing equivalents

  • Gluconeogenesis by providing precursors for glucose synthesis during glucose limitation

  • Nitrogen metabolism by supplying carbon skeletons for amino acid synthesis

Similar to other fungal transporters like CgDtr1, DIC1 likely contributes to stress tolerance mechanisms, potentially playing a role in the adaptation to changing environmental conditions. This is particularly relevant considering that C. glabrata must adapt to diverse host environments during infection, where substrate availability and stress factors vary significantly .

How does DIC1 expression in C. glabrata respond to different environmental stresses?

DIC1 expression in C. glabrata is dynamically regulated in response to various environmental stressors. Similar to the stress responses observed with other mitochondrial components, DIC1 expression is likely modulated by:

  • Oxidative stress: Upregulation helps maintain mitochondrial function when reactive oxygen species (ROS) levels increase, similar to how C. glabrata cells respond to oxidative stress that occurs during phagocytosis

  • Nutrient limitation: Expression increases during glucose depletion to facilitate alternative carbon source utilization

  • pH fluctuations: Changes in expression help maintain metabolic homeostasis in acidic environments

  • Temperature shifts: Thermoregulation of expression supports adaptation to fever conditions in the host

This adaptive expression pattern resembles the behavior of other mitochondrial components in C. glabrata under stress conditions. For instance, mitochondrial fusion and fission processes are known to be involved in C. glabrata's stress tolerance mechanisms, with environmental stressors like acetoin increasing intracellular ROS production and affecting mitochondrial integrity .

What structural features distinguish DIC1 from other mitochondrial transporters in C. glabrata?

DIC1 belongs to the mitochondrial carrier family (MCF) of proteins and shares several structural features with other MCF members while maintaining distinctive characteristics:

  • Contains approximately six transmembrane domains organized in three tandem repeats

  • Features a characteristic signature motif P-X-[D/E]-X-X-[K/R]

  • Possesses substrate-specific binding residues in the translocation pathway

  • Demonstrates a unique substrate selectivity filter that distinguishes it from other dicarboxylate carriers

The structural organization of DIC1 enables its specific interaction with dicarboxylic substrates, distinguishing it from other transporters like CgDtr1, which functions as a plasma membrane transporter involved in weak acid efflux and stress resistance .

What are the optimal conditions for expressing recombinant C. glabrata DIC1 in heterologous systems?

Successful expression of recombinant C. glabrata DIC1 requires careful optimization of expression systems and conditions. Based on approaches used for similar mitochondrial transporters, the following protocols are recommended:

Expression System Selection:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, rapid growthMay form inclusion bodiesInitial characterization
S. cerevisiaeNative-like processingLower yieldFunctional studies
P. pastorisHigh yield, eukaryotic processingLonger optimization timeLarge-scale production
Insect cellsSuperior folding of membrane proteinsComplex setup, expensiveStructural studies

Optimal Expression Protocol for E. coli:

  • Clone the DIC1 gene into a vector containing a C-terminal His-tag for purification

  • Transform into E. coli BL21(DE3) or C41(DE3) strains (specialized for membrane proteins)

  • Culture cells at lower temperatures (16-20°C) after induction to minimize inclusion body formation

  • Induce with 0.1-0.5 mM IPTG at mid-log phase (OD600 ≈ 0.6-0.8)

  • Extend expression time to 16-20 hours at the lower temperature

  • Supplement media with rare codons if needed based on C. glabrata codon usage

When designing expression constructs, consider fusion partners that can enhance solubility, similar to approaches used for expressing the C. glabrata multidrug transporter CgDtr1, which was successfully expressed using copper-inducible promoters .

What methods are most effective for assessing the transport activity of recombinant DIC1?

Evaluating the transport activity of recombinant DIC1 requires specialized assays that can monitor substrate movement across membranes. The following methodologies are particularly effective:

1. Liposome Reconstitution Assay:

  • Purify recombinant DIC1 and reconstitute into liposomes

  • Preload liposomes with substrate or establish a pH gradient

  • Measure substrate uptake/efflux using radiolabeled compounds or fluorescent probes

  • Calculate transport kinetics (Km, Vmax) from initial rate measurements

2. Whole-Cell Transport Assays:

  • Express DIC1 in transport-deficient yeast strains

  • Measure substrate accumulation or efflux using radiolabeled or fluorescent substrates

  • Compare transport rates with control strains lacking DIC1

3. Membrane Potential Measurements:

  • Monitor changes in membrane potential during transport using potential-sensitive fluorescent dyes

  • Correlate potential changes with transport activity

4. Mitochondrial Respirometry:

  • Isolate mitochondria from cells expressing recombinant DIC1

  • Measure oxygen consumption rates in response to different substrates

  • Compare respiratory capacity between wild-type and DIC1-enhanced mitochondria

For result validation, parallel experiments using inhibitors of mitochondrial dicarboxylate transport (such as butylmalonate or phenylsuccinate) can confirm specificity of the observed transport activity .

How can I purify recombinant C. glabrata DIC1 while maintaining its functional integrity?

Purifying membrane proteins like DIC1 while preserving their functional state is challenging. The following optimized protocol maintains structural integrity throughout the purification process:

Membrane Protein Purification Protocol:

  • Cell Lysis: Use gentle mechanical disruption (e.g., French press at 18,000 psi) in buffer containing protease inhibitors and 10% glycerol

  • Membrane Isolation: Perform differential centrifugation (10,000 × g to remove debris, then 100,000 × g to collect membranes)

  • Solubilization: Extract DIC1 using mild detergents such as:

    • 1% n-dodecyl-β-D-maltoside (DDM)

    • 1-2% digitonin

    • 0.5-1% lauryl maltose neopentyl glycol (LMNG)

  • Affinity Purification: Use immobilized metal affinity chromatography (IMAC) with extended binding times (2-3 hours at 4°C)

  • Size Exclusion Chromatography: Remove aggregates and further purify monodisperse protein

  • Stabilization: Maintain protein in buffer containing:

    • 0.05-0.1% DDM or 0.01-0.05% LMNG

    • 150-300 mM NaCl

    • 5-10% glycerol

    • 1 mM reducing agent (TCEP or DTT)

The critical factor is maintaining DIC1 in an environment that mimics the native mitochondrial membrane. This approach is similar to methods used for purifying other fungal membrane transporters, where protein stability and function are preserved through careful detergent selection and buffer optimization .

How do I interpret seemingly contradictory data about DIC1 transport kinetics?

Contradictory kinetic data for DIC1 transport activity can arise from multiple sources including experimental conditions, protein preparation methods, and physiological state of the cells. To properly interpret such data:

  • Systematically evaluate experimental variables:

    • Detergent effects: Different detergents can significantly alter protein conformation and activity

    • Lipid composition: The lipid environment affects transporter dynamics and substrate accessibility

    • pH and ion concentration: These can modify substrate binding and transport mechanisms

    • Temperature: Affects both protein dynamics and membrane fluidity

  • Consider substrate competition phenomena:

    • DIC1 likely transports multiple substrates with different affinities

    • Presence of competing substrates can yield apparent contradictions in single-substrate assays

    • Analyze transport using substrate mixtures that better reflect physiological conditions

  • Examine protein modifications:

    • Post-translational modifications may vary between preparations

    • Oxidation state of critical cysteine residues can affect transport activity

    • Phosphorylation status may regulate transport activity

Case Analysis Approach:
When faced with contradictory Km values for malate transport (e.g., values ranging from 0.8-2.5 mM in different experimental setups), create a comparative analysis table:

Experimental ConditionKm Value (mM)Vmax (nmol/min/mg)Possible Explanation for Variation
pH 6.8, 25°C, 0.05% DDM0.818.5Optimal pH for substrate protonation state
pH 7.4, 25°C, 0.05% DDM1.512.3Changed substrate charge affects binding
pH 6.8, 37°C, 0.05% DDM1.222.7Increased temperature enhances dynamics
pH 6.8, 25°C, 0.1% digitonin2.515.2Different detergent affects protein conformation

This methodical approach helps identify which variables most significantly impact transport kinetics and can resolve apparent contradictions in the data .

What statistical approaches are most appropriate for analyzing DIC1 activity data?

  • For kinetic parameter determination:

    • Non-linear regression using Michaelis-Menten or Hill equations for concentration-dependent activity

    • Bootstrap resampling to establish confidence intervals for Km and Vmax values

    • Eadie-Hofstee or Lineweaver-Burk transformations as complementary approaches (with awareness of their limitations)

  • For comparative studies:

    • ANOVA with post-hoc tests (Tukey or Bonferroni) when comparing multiple conditions

    • Mixed-effects models when analyzing repeated measures or nested experimental designs

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) when normality assumptions are violated

  • For inhibition studies:

    • IC50 determination using four-parameter logistic regression

    • Dixon plots for determining inhibition constants and mechanisms

    • Global fitting approaches for complex inhibition patterns

  • For quality control:

    • Outlier detection using Grubbs' test or Dixon's Q test

    • Power analysis to ensure adequate sample size

    • Bootstrapping for robust parameter estimation

For example, when analyzing the effect of oxidative stress on DIC1 transport activity, a repeated-measures ANOVA with post-hoc Dunnett's test comparing to control conditions would be appropriate, similar to approaches used in studying how oxidative stress affects the function of transporters like CgDtr1 in C. glabrata .

How can I distinguish between DIC1-specific effects and general mitochondrial dysfunction in my experiments?

Differentiating DIC1-specific effects from general mitochondrial dysfunction requires carefully designed control experiments and complementary analytical approaches:

  • Genetic controls:

    • Compare wild-type, DIC1 knockout, and DIC1-complemented strains

    • Use point mutants with specific transport defects but proper folding

    • Express structurally similar but functionally distinct transporters as controls

  • Pharmacological approaches:

    • Use DIC1-specific inhibitors (e.g., butylmalonate) versus general mitochondrial inhibitors

    • Compare effects of substrate analogs that specifically compete for DIC1 binding

    • Establish dose-response relationships to identify threshold effects

  • Comprehensive mitochondrial function assessment:

    • Measure membrane potential (ΔΨm) using JC-1 or TMRM dyes

    • Assess respiratory capacity through oxygen consumption rate measurements

    • Evaluate ROS production using fluorescent indicators

    • Analyze ATP production with luciferase-based assays

  • Temporal analysis:

    • Monitor the sequence of events following perturbation

    • Early, specific effects are more likely DIC1-related

    • Late, pleiotropic effects may indicate secondary mitochondrial dysfunction

Decision Matrix for Determining Effect Specificity:

ObservationDIC1 InhibitorGeneral Mito InhibitorDIC1 KnockoutComplemented StrainInterpretation
Reduced malate uptakeYesYesYesNoLikely DIC1-specific
Decreased ΔΨmNoYesNoNoGeneral mitochondrial effect
Increased ROSNoYesNoNoGeneral mitochondrial effect
Altered TCA metabolitesYesYesYesNoDIC1-specific effect

This systematic approach allows researchers to confidently attribute observed phenotypes to DIC1 function rather than general mitochondrial dysfunction, similar to approaches used to study the specific roles of transporters in C. glabrata stress responses .

How does DIC1 function contribute to C. glabrata stress tolerance and virulence?

DIC1's role in stress tolerance and virulence likely stems from its central position in mitochondrial metabolism and its ability to facilitate metabolic adaptations to changing environments:

  • Oxidative stress resistance:

    • DIC1 facilitates malate-aspartate shuttle function, supporting NADPH production for antioxidant systems

    • Proper dicarboxylate transport maintains mitochondrial function during oxidative stress

    • Similar to CgDtr1, DIC1 may help C. glabrata resist oxidative stress generated during phagocytosis by immune cells

  • Metabolic flexibility during infection:

    • DIC1 enables utilization of alternative carbon sources when glucose is limited in host niches

    • Supports gluconeogenesis from non-carbohydrate substrates

    • Facilitates adaptation to nutrient-poor environments within host tissues

  • pH adaptation:

    • Dicarboxylate transport contributes to pH homeostasis

    • Supports growth in acidic host environments, similar to how CgDtr1 protects against weak acid stress

    • May facilitate survival within phagolysosomes

  • Mitochondrial integrity maintenance:

    • Proper dicarboxylate transport prevents mitochondrial dysfunction

    • Contributes to mitochondrial fusion/fission balance under stress

    • Helps maintain energy production during host-imposed stresses

Experimental evidence from infection models suggests that transporters playing roles in stress adaptation significantly impact virulence. For example, deletion of the CgDtr1 transporter decreased C. glabrata's ability to kill Galleria mellonella larvae by 30%, with mutant cells showing reduced proliferation in the host . Similarly, mitochondrial fusion and fission processes, which DIC1 likely influences through its metabolic functions, are directly involved in C. glabrata stress tolerance .

What approaches are most effective for studying DIC1 structural dynamics during transport?

Advanced biophysical techniques provide insights into the structural dynamics of DIC1 during the transport cycle:

  • Site-Directed Spin Labeling (SDSL) with Electron Paramagnetic Resonance (EPR):

    • Introduce spin labels at specific residues throughout DIC1

    • Monitor distance changes and mobility during substrate binding and transport

    • Identify conformational changes associated with different steps of the transport cycle

  • Single-Molecule Förster Resonance Energy Transfer (smFRET):

    • Label pairs of residues with fluorophores

    • Observe real-time conformational changes at the single-molecule level

    • Determine the sequence and timing of structural transitions

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map regions of DIC1 with altered solvent accessibility during transport

    • Identify dynamic domains involved in substrate gating

    • Monitor structural changes under different substrate conditions

  • Molecular Dynamics (MD) Simulations:

    • Model DIC1 within a lipid bilayer

    • Simulate substrate binding and translocation events

    • Predict water accessibility pathways and energy barriers

Experimental Design for Conformational Analysis:

TechniqueInformation ObtainedExperimental ConditionsControls
SDSL-EPRDistance measurements between domainsProteoliposomes, 4-20°CSubstrate-free, transport-deficient mutants
smFRETReal-time conformational dynamicsDetergent-solubilized or reconstituted proteinSubstrate concentration series
HDX-MSSolvent accessibility changespH 7.0, varying temperaturesComparison with substrate analogs
MD SimulationsAtomic-level motion predictionsSimulated membrane environmentMultiple starting conformations

These techniques, when used in combination, provide complementary information about DIC1 structural dynamics during transport. This multi-technique approach has proven valuable for understanding the conformational changes of other mitochondrial transporters .

How can recombinant DIC1 be utilized for structure-based drug design targeting C. glabrata infections?

Recombinant DIC1 serves as an excellent platform for structure-based drug design, offering several strategic approaches:

  • High-resolution structural determination:

    • X-ray crystallography of DIC1 in different conformational states

    • Cryo-electron microscopy to visualize DIC1 in a near-native environment

    • NMR studies of substrate binding domains

  • Binding site characterization:

    • Identify critical residues through mutagenesis and functional studies

    • Characterize substrate binding pocket dimensions and electrostatic properties

    • Map species-specific differences between human and C. glabrata transporters

  • Fragment-based screening approaches:

    • Screen fragment libraries against purified DIC1

    • Identify binding hotspots using NMR, thermal shift assays, or SPR

    • Develop fragments into lead compounds with higher affinity and specificity

  • In silico screening pipeline:

    • Develop homology models based on high-resolution structures

    • Perform virtual screening of compound libraries

    • Filter compounds using molecular docking scores and predicted ADMET properties

  • Compound optimization strategy:

    • Focus on compounds with selectivity for fungal over human transporters

    • Optimize for mitochondrial targeting to increase local concentration

    • Balance hydrophobicity/hydrophilicity for appropriate membrane permeability

The development of DIC1 inhibitors represents a novel antifungal strategy, potentially addressing the growing problem of resistance to current antifungals. Similar approaches targeting fungal-specific transporters have shown promise in initial studies, with compounds disrupting mitochondrial function showing antifungal activity against C. glabrata .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.