Recombinant Candida glabrata Mitochondrial import inner membrane translocase subunit TIM21 (TIM21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TIM21; CAGL0K04059g; Mitochondrial import inner membrane translocase subunit TIM21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-215
Protein Length
Full Length of Mature Protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
TIM21
Target Protein Sequence
FYSSKGKSKGKTSGEKKPEHKKIPVWHKLKALTSFTASSLLVVGGVGVSGVVLYLILSEL FSPSGDTMLFNRAVTLVEDNEEVRKLLQCNDSSFKKERLKAYGELVTNDRWTRNRPIVST QKIDKYGKCHHFMRFHLESKKKLGLVHVEAVDSEQNYKPNFVSMYIDIPGEKRFYIIRPK LRQVVRPKSIFGFPWGSRKE
Uniprot No.

Target Background

Function
TIM21 is a crucial component of the TIM23 complex, responsible for translocating proteins with transit peptides across the mitochondrial inner membrane. It maintains close proximity between the TOM and TIM23 complexes. Its release from the TOM23 complex is essential for subsequent protein translocation into the mitochondrial matrix.
Database Links
Protein Families
TIM21 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the role of mitochondrial protein import in Candida glabrata pathogenesis?

Mitochondrial protein import pathways play a critical role in C. glabrata pathogenesis by enabling adaptation to host environments. These pathways facilitate the transport of proteins necessary for metabolic flexibility and stress responses. For instance, the evolutionary rewiring of mitochondrial import pathways appears to enhance C. glabrata's adaptability to specific environmental niches within the human host . Proper functioning of these import pathways ensures the assembly of respiratory complexes and metabolic enzymes that allow C. glabrata to utilize alternative carbon sources like lactate when glucose is limited in host tissues, providing a significant growth advantage .

How does C. glabrata adapt its mitochondrial import machinery in host environments?

C. glabrata adapts its mitochondrial import machinery in response to environmental pressures in the host. Research suggests that in glucose-poor niches of the human body, C. glabrata modifies its import pathways to efficiently transport proteins like Cyb2 (L-lactate cytochrome-c oxidoreductase) into the intermembrane space . This adaptation enables efficient utilization of alternative carbon sources such as lactate. Evidence indicates that C. glabrata is better at utilizing lactate than Saccharomyces cerevisiae under low oxygen conditions that mimic the hypoxic environment in host tissues . This metabolic flexibility contributes to C. glabrata's ability to thrive in various host niches, particularly in the gastrointestinal tract as demonstrated in murine infection models .

What experimental models are suitable for studying C. glabrata mitochondrial import proteins?

Several infection models have proven effective for studying C. glabrata mitochondrial proteins:

  • Galleria mellonella (wax moth) larvae model: This model has been successfully used to study C. glabrata virulence factors, including those related to stress response and mitochondrial function. The larval innate immune system has strong similarities to the mammalian innate immune system, particularly regarding hemocyte-dependent cellular responses that resemble mammalian macrophages .

  • Drosophila melanogaster infection model: Used for testing the virulence of C. glabrata mutants generated through CRISPR-Cas9 .

  • In vitro macrophage interaction assays: These can be used to study how mitochondrial proteins contribute to stress resistance within phagocytic cells .

  • Murine infection models: Though more complex, these have been used to study C. glabrata colonization of the gastrointestinal tract, demonstrating the importance of mitochondrial proteins like Cyb2 in lactate utilization .

What are the most effective genetic modification techniques for studying TIM21 function in C. glabrata?

For investigating TIM21 function in C. glabrata, CRISPR-Cas9 genome engineering has emerged as the most efficient approach. A robust experimental strategy includes:

  • Using a recombinant strain of C. glabrata constitutively expressing the CRISPR-Cas9 system .

  • Selection of efficient guide RNAs using specialized online programs designed for C. glabrata gene targeting .

  • Identification of mutant strains using the Surveyor technique followed by sequencing confirmation .

When generating TIM21 knockout mutants, researchers should consider the potential essentiality of this protein for mitochondrial function and cell viability. Conditional promoter systems or partial deletions may be necessary if complete deletion proves lethal.

For complementation studies, the copper-inducible C. glabrata MTI promoter system has been successfully used with other mitochondrial proteins and could be adapted for TIM21 expression. The expression plasmid construction would involve:

  • PCR amplification of the MTI promoter

  • Homologous recombination-based cloning

  • Verification by DNA sequencing

How can researchers assess the impact of TIM21 mutations on mitochondrial protein import in C. glabrata?

To assess TIM21's impact on mitochondrial protein import, researchers should implement a multi-faceted approach:

  • Transcriptional analysis: Employ quantitative real-time PCR to measure expression levels of TIM21 and other import machinery components under various stress conditions. This can be performed using RNA extracted from cells subjected to stressors like oxidative agents, weak acids, or antimycotics, as well as from cells internalized within host phagocytes .

  • Protein localization studies: Use fluorescent protein fusions or immunofluorescence microscopy to track the localization of mitochondrial proteins in wild-type versus TIM21 mutant strains.

  • In vitro import assays: Isolate mitochondria from wild-type and mutant strains to conduct comparative import efficiency assays using radiolabeled precursor proteins.

  • Blue Native-PAGE analysis: Assess the integrity of import complexes by examining protein-protein interactions within the TIM23 complex when TIM21 is mutated.

  • Functional consequences: Evaluate the impact on mitochondrial membrane potential, respiratory capacity, and ATP production using fluorescent dyes (e.g., TMRM, JC-1) and oxygen consumption measurements.

What experimental approaches can distinguish between the roles of TIM21 and other mitochondrial translocases in C. glabrata virulence?

To distinguish between the contributions of different mitochondrial translocases to C. glabrata virulence, researchers should consider:

  • Generate specific mutations: Create targeted mutations in TIM21 and other translocase components (e.g., TIM23, TIM17, TIM50) using CRISPR-Cas9 genome editing .

  • Virulence assays: Compare the virulence of different translocase mutants using the G. mellonella infection model, tracking mortality rates, fungal burden, and immune responses .

  • Hemocyte interaction assays: Isolate hemocytes from G. mellonella and perform in vitro interaction assays with different translocase mutants to assess phagocytosis rates, survival within phagocytes, and stress resistance .

  • Stress response differentiation: Subject mutants to various stressors (oxidative, acidic, osmotic) that mimic conditions within host phagocytes and analyze differential responses .

  • Substrate specificity analysis: Perform proteomic analysis of mitochondrial proteomes from different translocase mutants to identify specific substrates affected by each component.

  • Complementation experiments: Create double mutants and perform genetic complementation to assess functional redundancy or synergy between different import components.

How can researchers overcome challenges in differentiating between direct and indirect effects of TIM21 dysfunction?

Differentiating between direct and indirect effects of TIM21 dysfunction presents a significant challenge. To address this:

  • Use inducible expression systems: Employ the copper-inducible MTI promoter system to control TIM21 expression temporally, allowing observation of immediate versus delayed effects .

  • Perform time-course experiments: Track changes in mitochondrial function, protein import, and cell physiology at various time points after TIM21 depletion or mutation.

  • Employ specific import substrate analysis: Identify and track the import of known TIM21-dependent versus TIM21-independent substrates.

  • Conduct mitochondrial proteomics: Compare the mitochondrial proteome at different time points after TIM21 perturbation to identify primary and secondary effects.

  • Implement metabolic flux analysis: Use isotope-labeled metabolites to track changes in metabolic pathways following TIM21 disruption, distinguishing primary metabolic defects from compensatory responses.

  • Create functional domain mutants: Generate specific mutations in different functional domains of TIM21 rather than complete knockouts to elucidate domain-specific functions.

What are the best approaches for studying potential redundancy in mitochondrial import pathways?

To investigate redundancy in mitochondrial import pathways:

  • Generate combinatorial mutations: Create strains with mutations in multiple import components, such as TIM21 along with components of other import pathways.

  • Conditional expression systems: Use regulatable promoters to independently control the expression of potentially redundant import factors.

  • Substrate tracking experiments: Track the import of specific mitochondrial proteins in single and combinatorial mutants to identify shifts in import pathway usage.

  • Proteomics analysis: Employ quantitative proteomics to assess global changes in mitochondrial protein composition across different mutant strains.

  • Evolutionary analysis: Compare import pathway components across related Candida species that inhabit different niches to identify evolutionarily conserved redundancies that may indicate functional importance.

  • Stress-specific phenotyping: Characterize mutant phenotypes under various stress conditions to identify condition-specific requirements for different import pathways.

How might understanding TIM21 function contribute to developing new antifungal strategies?

Understanding TIM21 function could lead to novel antifungal approaches through:

  • Target identification: If TIM21 has unique structural or functional features in C. glabrata compared to humans, it could represent a selective target for antifungal development.

  • Virulence attenuation: Similar to how CgDtr1 deletion decreases virulence in the G. mellonella model , targeting TIM21 might attenuate virulence without directly killing the pathogen, potentially reducing selective pressure for resistance development.

  • Combination therapies: Inhibitors of mitochondrial import might sensitize C. glabrata to existing antifungals by compromising stress adaptation mechanisms.

  • Host niche adaptation interference: Since mitochondrial import appears critical for adaptation to specific host niches through metabolic flexibility , targeting TIM21 might prevent successful colonization of certain host tissues.

  • Biofilm formation inhibition: If TIM21 contributes to biofilm formation through its role in stress adaptation, targeting it could reduce biofilm-associated infections.

How does host environment influence the expression and function of TIM21 in C. glabrata during infection?

The host environment likely regulates TIM21 expression and function through:

  • Transcriptional regulation: Similar to CgDTR1, which shows dramatically increased expression within hemocytes , TIM21 may be transcriptionally regulated in response to host cell internalization.

  • Metabolic adaptation: In glucose-limited host niches, TIM21 might facilitate the import of proteins required for alternative carbon source utilization, similar to the role of mitochondrial import in lactate metabolism .

  • Hypoxic responses: Low oxygen conditions in host tissues may alter the requirements for mitochondrial import components, as C. glabrata shows enhanced lactate utilization under hypoxic conditions .

  • Stress response integration: The host immune response generates various stressors (oxidative, pH, nutrient limitation) that may trigger adaptive changes in mitochondrial import machinery, as seen with other stress response factors in C. glabrata .

  • Temporal dynamics: TIM21 function may change during different phases of infection, from initial colonization to dissemination and persistence within host tissues.

How does TIM21 function differ between C. glabrata and other pathogenic fungi?

While specific information about TIM21 differences is limited in the search results, we can draw insights from evolutionary patterns of mitochondrial import pathways:

  • Evolutionary rewiring: Similar to how pathways for intermembrane space protein import have been rewired through evolution , TIM21 function may have undergone pathogen-specific adaptations in C. glabrata.

  • Niche specialization: C. glabrata's ability to thrive in diverse host niches might be reflected in unique properties of its TIM21 protein compared to other fungi.

  • Stress response integration: The integration of TIM21 with stress response pathways may differ between fungal species based on their predominant environmental challenges.

  • Substrate specificity: TIM21 in C. glabrata might have evolved to prioritize the import of proteins particularly important for its pathogenic lifestyle.

  • Regulatory mechanisms: The regulation of TIM21 expression and activity may differ between species, reflecting their distinct metabolic requirements and virulence strategies.

What can researchers learn from S. cerevisiae TIM21 studies that might apply to C. glabrata research?

S. cerevisiae research provides valuable insights that can guide C. glabrata TIM21 investigations:

  • Functional conservation: Core functions of TIM21 in the TIM23 complex are likely conserved, providing a foundation for understanding its role in C. glabrata.

  • Methodological approaches: Techniques developed for studying S. cerevisiae mitochondrial import can be adapted for C. glabrata research, including protein import assays and complex analysis methods.

  • Differential aspects: Comparing TIM21 function between S. cerevisiae and C. glabrata might reveal pathogen-specific adaptations, similar to how these species differ in lactate utilization under hypoxic conditions .

  • Genetic tools transfer: CRISPR-Cas9 and other genetic modification strategies developed for yeast can be adapted for C. glabrata, as demonstrated by the development of genome engineering tools .

  • Respiratory adaptation differences: S. cerevisiae, as a facultative anaerobe, has different respiratory requirements than C. glabrata, which may be reflected in their respective mitochondrial import machinery functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.