Recombinant Candida glabrata Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling this request.
Synonyms
TIM54; CAGL0J05016g; Mitochondrial import inner membrane translocase subunit TIM54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
TIM54
Target Protein Sequence
MNPALKALGLGNFKLPSRNWTIFWTVLAGSLGGVGYDKYQQRQIISRYCDEVKPLSLQHC DVNKSPRKITVFIAPPPNDYLETSLKIWRRYIKPVLYYAGLDYEVIEEDRQGIIRSEVAS RIRQLRRELLEADNEQQGNSGDSLLSIFKKPHAKDPEEEQKFDPEQARQFKADFDFRNVM GIYTKVPKLDTIVQTDSLVADPVLAGGVVCVGRGAYKEYITGLHEGLLGPLDPPEETTQE VEMGSKLKSMNDGDNVETTVETAVETMVETTLESADKVEVEGKDTENEEGKDEPDEEKSR VLKPYLLRTAFHDTPIPPEVEPVLEKDALLKDPKTNVPSLLHQPVLVIPVPNLIGFLTIP ERIYRFYQRRFFVDEVCREASNLVKQEHIVKYEPDKHINLALEEESDWPKQWVKTGIEKN SEWTQELVQDQRVVSKMHVFELPKHTTKDTKE
Uniprot No.

Target Background

Function

Recombinant Candida glabrata Mitochondrial Import Inner Membrane Translocase Subunit TIM54 (TIM54) is an essential component of the TIM22 complex. This complex mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex functions as a twin-pore translocase, utilizing the membrane potential as its driving force.

Database Links
Protein Families
TIM54 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of TIM54 in C. glabrata mitochondria?

TIM54 in C. glabrata functions as an essential component of the inner membrane TIM22 complex, responsible for the assembly and stability of the 300-kD TIM22 complex rather than directly mediating import of inner membrane substrates. Similar to its homolog in other yeasts, C. glabrata TIM54 is critical for maintaining mitochondrial function and genome stability.

The protein facilitates the proper assembly of other TIM complex components, creating a functional scaffold for the import machinery. TIM54 deletion mutants (Δtim54) demonstrate a petite-negative phenotype, indicating that cells cannot survive without their mitochondrial genome when TIM54 is absent . This suggests that, unlike some protein import defective mutants, TIM54's role extends beyond simple protein translocation to broader mitochondrial maintenance functions.

Methodologically, researchers can verify TIM54 function through:

  • Complementation assays with wild-type TIM54

  • Protein-protein interaction studies with other TIM complex components

  • Mitochondrial import assays using radiolabeled precursor proteins

How does C. glabrata TIM54 differ from homologs in other yeast species?

While TIM54 proteins maintain conserved structural elements across fungal species, C. glabrata TIM54 shows distinct characteristics reflecting this pathogen's evolutionary adaptations:

SpeciesTIM54 FeatureFunctional Implication
C. glabrataPetite-negative phenotype in deletion mutantsEssential for mtDNA maintenance
S. cerevisiaeSimilar petite-negative phenotypeConserved functional role
Other Candida speciesVariable phenotypic responsesSpecies-specific adaptations

The petite-negative phenotype observed in C. glabrata Δtim54 strains is similar to that seen in S. cerevisiae, but contrasts with some protein import mutants (tim22 and tim23) that exhibit petite-positive phenotypes (can survive without mitochondrial DNA) . This conservation suggests fundamental importance of TIM54 across yeast species but with potential pathogen-specific modifications.

To investigate these differences experimentally, researchers should perform:

  • Phylogenetic analyses of TIM54 sequences across Candida species

  • Complementation studies using TIM54 from different species

  • Comparative phenotypic analyses of deletion mutants

What experimental techniques are most effective for TIM54 localization in C. glabrata?

For accurate subcellular localization of TIM54 in C. glabrata, researchers should employ multiple complementary approaches:

  • Fluorescence microscopy with GFP fusion proteins

    • Generate C-terminal GFP-tagged TIM54 using PCR-based tagging methods

    • Co-localize with mitochondrial markers (e.g., MitoTracker dyes)

    • Verify that the fusion protein maintains functionality through complementation assays

  • Subcellular fractionation and Western blotting

    • Isolate intact mitochondria using differential centrifugation

    • Perform protease protection assays to determine membrane topology

    • Analyze specific mitochondrial subfractions (outer membrane, intermembrane space, inner membrane, matrix)

  • Immunoelectron microscopy

    • Use TIM54-specific antibodies with gold-conjugated secondary antibodies

    • Precisely determine submitochondrial localization at nanometer resolution

These approaches have confirmed that, like in other yeasts, C. glabrata TIM54 localizes primarily to the mitochondrial inner membrane, consistent with its role in the TIM22 complex .

How can recombinant C. glabrata TIM54 be efficiently expressed and purified for structural studies?

For structural and functional studies of C. glabrata TIM54, researchers need highly purified protein. Based on successful approaches with similar membrane proteins, we recommend:

Expression system options:

  • Bacterial expression (E. coli)

    • Clone CgTIM54 into pET vectors with N-terminal His6 or MBP tags

    • Express in specialized strains (C41/C43) designed for membrane proteins

    • Induce at lower temperatures (16-20°C) to improve folding

    • Challenges: Potential toxicity and inclusion body formation

  • Yeast expression (S. cerevisiae or P. pastoris)

    • Use strong inducible promoters (GAL1 or copper-inducible MTI)

    • Add C-terminal epitope tags for detection and purification

    • Express in protease-deficient strains to minimize degradation

    • Advantages: Proper folding and post-translational modifications

Purification protocol:

  • Solubilize membranes with mild detergents (DDM or LMNG)

  • Use tandem affinity purification with His-tag and secondary tag

  • Apply size exclusion chromatography for final purity

  • Verify protein integrity by mass spectrometry

Researchers have successfully used similar approaches for other membrane proteins from C. glabrata, including drug transporters like CgFlr1 and CgFlr2, which were expressed using copper-induced MTI promoters in plasmid constructs .

What approaches can identify the TIM54 interactome in C. glabrata?

Understanding TIM54's interaction network is crucial for elucidating its functions. We recommend multiple complementary methods:

  • Proximity-dependent biotin labeling (BioID or TurboID)

    • Fuse TIM54 to a biotin ligase

    • Identify proximal proteins via streptavidin pulldown and mass spectrometry

    • Advantage: Captures transient and weak interactions in native conditions

  • Co-immunoprecipitation with quantitative proteomics

    • Use epitope-tagged TIM54 (HA, FLAG, or GFP)

    • Compare wildtype vs. tim54 mutant strains using SILAC or TMT labeling

    • Apply stringent statistical analysis to identify specific interactors

  • Genetic interaction mapping

    • Perform synthetic genetic array (SGA) analysis with tim54 mutants

    • Identify genes showing synthetic lethality or suppression

    • Map the functional network surrounding TIM54

  • Split-reporter assays for binary interactions

    • Use split-GFP or yeast two-hybrid systems

    • Verify direct protein-protein interactions

    • Test interactions with candidate proteins identified in other screens

When applying these methods to C. glabrata TIM54, researchers should focus on interactions with other mitochondrial import components, proteins involved in mitochondrial membrane organization, and potential pathogen-specific interactors that may reveal unique functions in this opportunistic pathogen.

How does TIM54 dysfunction affect mitochondrial function and drug resistance in C. glabrata?

TIM54 dysfunction significantly impacts both mitochondrial function and potentially drug resistance mechanisms in C. glabrata:

Mitochondrial effects:

  • TIM54 mutants (Δtim54 and tim54-3) show a petite-negative phenotype, meaning they cannot survive without their mitochondrial DNA

  • This suggests a critical role in maintaining mitochondrial genome stability

  • Import of certain mitochondrial proteins (Hsp60, Tim23p) is slowed but not completely blocked in TIM54 mutants

  • Interestingly, steady-state levels of these proteins remain relatively normal, suggesting compensatory mechanisms exist

Potential connections to drug resistance:

  • Mitochondrial dysfunction in C. glabrata is linked to altered drug susceptibility profiles

  • Petite strains (with mitochondrial DNA loss) show enhanced echinocandin tolerance

  • The membrane proteome response to antifungal drugs like 5-flucytosine involves many mitochondrial proteins

To investigate these connections experimentally:

  • Generate conditional TIM54 mutants and assess drug susceptibility profiles

  • Perform transcriptomic and proteomic analyses to identify altered pathways

  • Measure reactive oxygen species levels and membrane potential in TIM54 mutants

  • Test for cross-resistance to different antifungal classes

Strain TypeEchinocandin SusceptibilityAzole SusceptibilityMitochondrial Function
Wild-typeNormalNormalNormal
TIM54 mutantsPotentially alteredPotentially alteredImpaired
Petite strainsDecreased (more tolerant) VariableSeverely compromised

Understanding these relationships could reveal novel therapeutic strategies targeting mitochondrial function in drug-resistant C. glabrata isolates.

What role might TIM54 play in C. glabrata pathogenesis and host-pathogen interactions?

While direct evidence for TIM54's role in C. glabrata pathogenesis is limited, several lines of evidence suggest potential significance:

  • Mitochondrial function and stress adaptation

    • TIM54 is essential for maintaining mitochondrial function

    • Proper mitochondrial function is crucial for stress responses encountered during infection

    • Mutants with mitochondrial dysfunction show altered interactions with host immune cells

  • Connection to petite phenotypes and host responses

    • Petite variants of C. glabrata show distinct behaviors in host interactions

    • In macrophage infection models, petite cells exhibit non-growth phenotypes

    • Macrophages infected with petite strains show pronounced type-I interferon and pro-inflammatory cytokine responses at later infection stages

  • Potential role in interspecies interactions

    • C. glabrata often co-infects with other Candida species, particularly C. albicans

    • Mitochondrial function may influence the production of signaling molecules that mediate these interactions

    • Recently identified interspecies communication molecules like Yhi1 highlight the importance of such interactions

To investigate TIM54's role in pathogenesis:

  • Create conditional TIM54 mutants suitable for in vivo studies

  • Assess virulence in relevant animal models

  • Examine interactions with host immune cells

  • Evaluate fitness during co-infection with other Candida species

Understanding TIM54's role in pathogenesis could reveal new strategies for therapeutic intervention in C. glabrata infections, which are increasingly resistant to conventional antifungals.

How can CRISPR-Cas9 genome editing be optimized for studying TIM54 function in C. glabrata?

CRISPR-Cas9 offers powerful approaches for studying TIM54 function in C. glabrata, but requires specific optimization for this pathogenic yeast:

CRISPR-Cas9 strategy for TIM54 studies:

  • Guide RNA design

    • Select target sites with minimal off-target effects

    • Target conserved functional domains of TIM54

    • Create multiple gRNAs targeting different regions

    • Use C. glabrata-optimized RNA polymerase III promoters (e.g., SNR52)

  • Delivery methods

    • Assemble Cas9 and gRNA expression cassettes on a single plasmid

    • Include selectable markers appropriate for C. glabrata (e.g., NAT1, HYG)

    • Use lithium acetate transformation with carrier DNA

    • Introduce repair templates for precise gene editing

  • Generating specific TIM54 modifications

Modification TypeApproachApplication
Complete knockoutCRISPR-mediated deletionBasic function studies
Point mutationsHDR with specific templatesStructure-function analysis
Domain deletionsHDR with modified templatesIdentifying essential regions
TaggingC-terminal epitope tag insertionLocalization and interaction studies
Conditional allelesInsert regulatable promoterStudying essential gene functions
  • Validation strategies

    • PCR verification of modifications

    • Sanger sequencing of edited loci

    • Western blotting for protein expression

    • Phenotypic characterization

    • Whole-genome sequencing to detect off-target effects

When applying CRISPR to study TIM54, researchers should be aware that complete deletion may be lethal due to the petite-negative phenotype , necessitating conditional approaches or specific point mutations to study function.

What are the best approaches for isolating functional mitochondria from C. glabrata for TIM54 studies?

Isolating functional mitochondria from C. glabrata requires specific adaptations of established protocols:

Optimized isolation protocol:

  • Cell growth and preparation

    • Grow cultures in YPG or YPL media to promote mitochondrial development

    • Harvest cells at late-log phase (OD600 ≈ 1.0-1.5)

    • Pretreat with DTT and Zymolyase to generate spheroplasts

    • Homogenize gently using Dounce homogenizer

  • Differential centrifugation

    • Remove cell debris with low-speed centrifugation (1,500 × g)

    • Collect crude mitochondria at 12,000 × g

    • Purify through sucrose gradient ultracentrifugation

  • Quality assessment

    • Measure respiratory control ratio

    • Assess membrane potential with fluorescent dyes

    • Verify protein import competence with radiolabeled precursors

    • Check integrity by protease protection assays

  • Special considerations for TIM54 studies

    • Use protease inhibitor cocktails specific for yeast

    • Minimize time between cell disruption and mitochondrial isolation

    • Verify TIM54 integrity by Western blotting

This approach yields intact mitochondria suitable for import assays, protein complex analysis, and functional studies of TIM54 and the TIM22 complex.

How can researchers distinguish between direct and indirect effects of TIM54 dysfunction?

Distinguishing direct and indirect effects of TIM54 dysfunction requires multiple complementary approaches:

  • Acute vs. chronic disruption

    • Use temperature-sensitive alleles for acute inactivation

    • Compare with long-term deletion effects

    • Monitor time-course of changes after TIM54 inactivation

  • Targeted protein depletion

    • Implement an auxin-inducible degron system for rapid TIM54 depletion

    • Monitor primary effects occurring immediately after depletion

    • Secondary effects typically appear later in the time course

  • Separation of essential and non-essential functions

    • Create partial loss-of-function mutants

    • Identify specific domains required for different functions

    • Perform comprehensive phenotypic profiling

  • Integration with interactome data

    • Direct effects likely involve known TIM54 interacting partners

    • Indirect effects may affect pathways without physical interaction

    • Combine with temporal proteomics to establish causality

  • Rescue experiments

    • Test which phenotypes can be rescued by specific interacting proteins

    • Investigate whether overexpression of other TIM complex components can compensate for TIM54 dysfunction

When studying protein import defects in TIM54 mutants, researchers should note that in vivo import may be more efficient than in vitro import, or protein turnover might be decreased to compensate for reduced import rates . This explains why steady-state levels of imported proteins may appear normal despite reduced import rates in isolated mitochondria.

How does TIM54 function relate to C. glabrata stress responses and antifungal resistance?

TIM54's role in maintaining mitochondrial function potentially connects to stress response mechanisms and antifungal resistance in C. glabrata:

  • Mitochondrial function and stress adaptation

    • Mitochondria are central to cellular stress responses

    • TIM54 dysfunction may impair adaptation to oxidative, osmotic, and temperature stresses

    • These stresses are commonly encountered during infection and antifungal treatment

  • Connections to known resistance mechanisms

    • The membrane proteome response to antifungals like 5-flucytosine involves numerous mitochondrial proteins

    • Drug efflux transporters like CgFlr1 and CgFlr2, which confer resistance to antifungals including 5-flucytosine, may have altered expression or localization in TIM54 mutants

    • Petite strains of C. glabrata show enhanced tolerance to echinocandins, suggesting mitochondrial dysfunction can directly impact drug susceptibility

  • Redox balance and drug detoxification

    • Mitochondria influence cellular redox state

    • Altered redox balance affects drug detoxification enzymes

    • TIM54 dysfunction may indirectly affect these processes

Experimental approaches to investigate these relationships include:

  • Transcriptomic and proteomic profiling of TIM54 mutants under antifungal stress

  • Measuring intracellular drug accumulation in wildtype vs. TIM54 mutant strains

  • Determining minimum inhibitory concentrations of various antifungals

  • Examining expression of drug efflux transporters in TIM54 mutants

Understanding these connections could help address the growing challenge of antifungal resistance in C. glabrata.

What comparative insights can be gained by studying TIM54 across different Candida species?

Comparative analysis of TIM54 across Candida species offers valuable insights into evolution, adaptation, and species-specific functions:

  • Evolutionary conservation and divergence

    • Core domains essential for TIM complex assembly are likely conserved

    • Species-specific adaptations may relate to unique ecological niches

    • Rates of evolutionary change may indicate selective pressures

  • Functional differences across species

    • The petite-negative phenotype of TIM54 mutants in C. glabrata may differ in other species

    • Import substrate specificity could vary based on metabolic requirements

    • Interaction networks may include species-specific partners

  • Correlation with pathogenicity

    • Differences in TIM54 function may correlate with virulence potential

    • Species-specific mitochondrial adaptations could influence host interactions

    • Thermal tolerance differences may relate to TIM54 stability across species

  • Therapeutic implications

    • Species-specific features could be exploited for selective targeting

    • Conservation analysis helps identify essential vs. adaptable functions

    • Understanding structural differences guides inhibitor design

Experimental approaches for comparative studies:

  • Heterologous expression of TIM54 from different species in C. glabrata

  • Reciprocal complementation assays to test functional conservation

  • Comparative interaction mapping across species

  • Structural modeling to identify species-specific features

This comparative approach not only enhances fundamental understanding but may also reveal potential species-selective therapeutic targets.

What are the most promising future research directions for C. glabrata TIM54?

The study of TIM54 in C. glabrata offers several promising research directions:

  • Structural biology

    • Determine high-resolution structure of TIM54 and the TIM22 complex

    • Identify binding interfaces with partner proteins

    • Understand conformational changes during protein import

  • Role in pathogenesis

    • Investigate TIM54's influence on virulence in animal models

    • Examine its role in adaptation to host microenvironments

    • Study its impact on interactions with other microbes during co-infection

  • Therapeutic targeting

    • Explore TIM54 or associated processes as antifungal targets

    • Develop screening assays for TIM54 function inhibitors

    • Assess synergy between mitochondrial inhibitors and current antifungals

  • Systems biology integration

    • Place TIM54 function within broader cellular networks

    • Model how mitochondrial import affects global cellular functions

    • Understand compensatory mechanisms that respond to TIM54 dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.