Recombinant Candida glabrata Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MGR1; CAGL0B00682g; Mitochondrial inner membrane i-AAA protease complex subunit MGR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-483
Protein Length
full length protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
MGR1
Target Protein Sequence
MGIFTPPGKSDKRDANEEKPTLLGSNSKDETDVEKFWVRPSLGLKLWGPLVPASDNKTGL WTLVAVQSMVGLLCFYRFKSLRIIDRNGALNSVGKSGIRPTSVLVNEPKLYNSAFTQQEA VSGKPLVKKDIADFPTLNRFSTTHGDMFVNTTNVNRNTPSLSAAPVVASPVLSSAGHQSE IMAKSEAKNNWKSFFKSDNWLIFKKVFYLLAGSIILSQSMLEACRLTILRYDPWCEEAKT VREKKFFNNIVKFYHEGIDPTKVKVKDAVSGNIMPTNVPEVRQSVALVRAQTEAENPIIS WFGPIEYKPMTFSEFLDRLEYHLDMFEYFQGKRAANETALGFLTGIKTETSNLRDQNAQN RSRILKELKSEDQLSNDLSIKTGNAKIPKGTQRHGFSAAANRSIILEEDVAVPEDIDLNE IWTLYDPWLNLALETSLSIKFIPTVLINQDGITENSMMDTEATIGDKAGVIPENSNKPEE PRQ
Uniprot No.

Target Background

Function
Component of the mitochondrial inner membrane i-AAA protease complex; essential for the turnover of mitochondrial inner membrane proteins.
Database Links
Protein Families
MGR1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the MGR1 protein in Candida glabrata and what is its primary function?

MGR1 is a subunit of the mitochondrial inner membrane i-AAA protease complex in Candida glabrata. It functions as an adaptor protein that facilitates substrate recognition and binding for the i-AAA protease complex. The i-AAA protease, with Yme1p as its catalytic subunit, is responsible for quality control of mitochondrial inner membrane proteins.

MGR1 specifically forms a subcomplex with Mgr3p, and together they bind to the i-AAA subunit Yme1p. These proteins play a critical role in mitochondrial protein homeostasis by targeting misfolded or damaged proteins for degradation, which is essential for maintaining mitochondrial function and integrity .

How does MGR1 contribute to the function of the i-AAA protease complex?

MGR1 enhances the proteolytic efficiency of the i-AAA complex through multiple mechanisms:

  • Substrate recognition and binding: MGR1, along with Mgr3p, can bind substrates even in the absence of Yme1p (the catalytic component), acting as a substrate recognition module .

  • Stabilization of the complex: MGR1 helps maintain the structural integrity of the i-AAA protease complex. Loss of MGR1 results in altered complex migration patterns during blue native gel electrophoresis .

  • Substrate delivery: MGR1 tethers the Mgr3p-MGR1 subcomplex to the i-AAA protease, facilitating efficient delivery of substrates to the catalytic core .

Research has shown that deletion of MGR1 reduces proteolysis by Yme1p, with substrates like Nde1p-HA showing extended half-lives in MGR1-deficient cells (increasing from ~25 min in wild-type to ~36 min in Δmgr1 mutants) .

What experimental systems are available for studying MGR1 in Candida glabrata?

Several experimental systems have been established for studying MGR1 in C. glabrata:

Experimental ApproachDetailsApplications
Gene deletion mutantsΔcgmgr1 strainsPhenotypic analysis, virulence studies
Epitope taggingMGR1-myc, MGR1-His6Protein interaction studies, localization
Expression plasmidspGREG576_MTI_CgDTR1Overexpression studies
Infection modelsGalleria mellonella larvaeIn vivo virulence assessment
Proteolysis assaysNde1p-HA fusion proteinMeasuring protein degradation kinetics

For studying protein-protein interactions, co-immunoprecipitation experiments using digitonin-solubilized mitochondria have been particularly informative in determining how MGR1 interacts with other components of the i-AAA complex .

What is the relationship between MGR1 and virulence in Candida glabrata infections?

The relationship between MGR1 and virulence in C. glabrata is complex and multifaceted. Recent studies using the Galleria mellonella infection model have provided important insights:

Virulence phenotypes:

  • Wild-type C. glabrata strains expressing MGR1 show higher virulence compared to Δmgr1 deletion mutants

  • Δmgr1 mutants demonstrated approximately 30% reduced killing ability against G. mellonella larvae

  • Overexpression of MGR1 in wild-type backgrounds led to a 50% decrease in G. mellonella survival rate

Mechanism of virulence contribution:

  • Proliferation in host: MGR1 enhances C. glabrata proliferation within the host. After 48 hours of infection, wild-type cells were found at concentrations 4.5-fold higher than Δmgr1 mutant populations in G. mellonella hemolymph .

  • Stress resistance: MGR1 confers resistance to stresses encountered during infection, particularly oxidative and acetic acid stress within phagocytes .

  • Survival in phagocytes: MGR1 helps C. glabrata persist within hemocytes (similar to mammalian macrophages), potentially by facilitating adaptation to the hostile intracellular environment .

These findings suggest that MGR1 acts as a fitness factor that promotes C. glabrata virulence by enhancing proliferation and survival during host-pathogen interactions.

How does the study of MGR1 inform our understanding of antifungal resistance mechanisms in Candida glabrata?

Research on MGR1 and mitochondrial function has revealed important connections to antifungal resistance in C. glabrata:

  • Mitochondrial dysfunction and azole resistance: Studies show that mitochondrial dysfunction in C. glabrata is linked to increased azole resistance. While not directly investigating MGR1, research on other mitochondrial components like GEM1 (a GTPase regulating the ERMES complex) demonstrates how mitochondrial morphology abnormalities lead to azole resistance .

  • Respiratory metabolism and drug efflux: Mitochondrial dysfunction, including alterations in i-AAA protease complex function, can lead to metabolic reprogramming that affects drug efflux pump expression. For example, cells lacking GEM1 showed upregulation of CDR1 and CDR2 genes, which encode major azole resistance drug efflux pumps .

  • Cross-resistance phenomena: Mitochondrial dysfunction can confer cross-resistance between antifungals and host immune defenses. The petite phenotype resulting from mitochondrial DNA loss increases C. glabrata's resistance to both azoles and endoplasmic reticulum stress, while enhancing survival in phagocytes .

  • Echinocandin tolerance: Mitochondria play a multifactorial role in echinocandin tolerance in C. glabrata. Transcriptomic analysis of echinocandin-tolerant cells revealed downregulation of oxidative stress responses despite increased levels of reactive oxygen species, implicating mitochondrial processes in drug tolerance mechanisms .

These findings suggest that targeting mitochondrial adaptors like MGR1 could potentially sensitize C. glabrata to antifungals by disrupting stress response mechanisms that contribute to drug resistance.

What methodologies are most effective for purifying and characterizing recombinant MGR1 protein from Candida glabrata?

Based on current research approaches, the following methodologies are recommended for purifying and characterizing recombinant MGR1:

Expression Systems:

Host SystemAdvantagesConsiderations
E. coliHigh yield, economical, rapid expressionMay lack proper post-translational modifications
Yeast (S. cerevisiae)Native-like processing, proper foldingLower yield than bacterial systems
BaculovirusSuitable for complex eukaryotic proteinsMore technically demanding
Mammalian cellBest for complex eukaryotic proteinsHighest cost, lower yield

Purification Strategy:

  • Affinity Tagging: His6-tagging has been successfully employed for MGR1 purification, allowing for metal affinity chromatography .

  • Solubilization: Digitonin has proven effective for solubilizing MGR1 from mitochondrial membranes while preserving protein-protein interactions .

  • Blue Native PAGE: Valuable for analyzing intact complexes containing MGR1, revealing its association with the larger i-AAA complex .

  • Size Exclusion Chromatography: Useful for separating the intact i-AAA complex from free MGR1 and other mitochondrial proteins.

Functional Characterization Approaches:

  • Substrate Binding Assays: Using model substrates such as Yta10(161)-DHFR^MUT^ to assess MGR1's ability to bind unfolded proteins .

  • Proteolysis Assays: Employing fusion proteins like Nde1p-HA as substrates to measure proteolytic activity in the presence or absence of MGR1 .

  • Co-immunoprecipitation: Essential for mapping interaction networks of MGR1 with other i-AAA complex components and potential substrates .

When purifying MGR1, maintaining ≥85% purity as determined by SDS-PAGE is recommended for most applications .

How does MGR1 from Candida glabrata compare functionally with homologs in other fungal species?

Comparative analysis reveals both conservation and divergence in MGR1 structure and function across fungal species:

SpeciesMGR1 HomologKey DifferencesFunctional Implications
Saccharomyces cerevisiaeMGR1Higher sequence conservationWell-characterized adaptor for i-AAA complex
Candida albicansHypothetical protein CaO19.874Lower sequence identityLess characterized, presumed adaptor function
Kluyveromyces lactisKLLA0_C01089gFunctional conservationSimilar role in mitochondrial quality control
Lodderomyces elongisporusLELG_01282Conserved functional domainsSimilar adaptor role predicted
Ashbya gossypiiAGOS_AFR719WSimilar domain organizationFunctional conservation expected

In S. cerevisiae, MGR1 was initially identified through a genomewide screen for petite-negative yeast strains, highlighting its importance in mitochondrial DNA maintenance . This function appears conserved in C. glabrata, where mitochondrial genome integrity influences drug resistance and virulence .

What are the optimal conditions for expressing recombinant MGR1 from Candida glabrata?

Based on research practices, the following conditions are recommended for optimal expression of recombinant C. glabrata MGR1:

Expression Host Selection:

  • For structural studies: E. coli BL21(DE3) with codon optimization

  • For functional studies: S. cerevisiae expression systems (particularly in MGR1-deficient backgrounds)

  • For interaction studies: Cell-free expression systems can provide rapid results for initial screening

Expression Conditions:

  • For E. coli systems:

    • Induction: 0.1-0.5 mM IPTG

    • Temperature: 16-18°C for 16-20 hours (reduced temperature improves folding)

    • Media: Consider enriched media supplemented with glucose to enhance yield

  • For yeast systems:

    • Media: BM minimal medium containing 20 g/L of D-(+)-glucose, 1.7 g/L of Yeast-Nitrogen-Base, and 2.65 g/L ammonium sulfate

    • Growth conditions: 30°C with appropriate selection markers

Protein Extraction:

  • Cell lysis: For mitochondrial membrane proteins, gentle lysis methods are preferred

  • Membrane solubilization: Digitonin (1%) has been effectively used to solubilize MGR1 while maintaining protein-protein interactions

  • Buffer composition: Tris-based buffers (pH 7.4-8.0) with 50% glycerol for stability during storage

Quality Control:

  • Verify protein expression by Western blotting using anti-His or anti-MGR1 antibodies

  • Assess purity by SDS-PAGE (target ≥85% purity)

  • Confirm functionality through substrate binding assays or complementation of MGR1-deficient strains

How can researchers effectively study the interaction between MGR1 and other components of the i-AAA protease complex?

Several complementary approaches can be employed to study MGR1 interactions within the i-AAA protease complex:

1. Co-immunoprecipitation (Co-IP):

  • Tag MGR1 with epitopes such as His6 or myc

  • Solubilize mitochondrial membranes with digitonin (preserves protein-protein interactions)

  • Use magnetic beads conjugated with anti-tag antibodies

  • Analyze co-precipitated proteins by Western blotting or mass spectrometry

In previous studies, this approach revealed that:

  • MGR1-myc co-precipitates with Yme1p and Mgr3p from mitochondrial extracts

  • The MGR1-Yme1p interaction is reduced by ~64% in the absence of Mgr3p

  • MGR3p-Yme1p interaction absolutely requires MGR1, establishing MGR1 as the tether between Mgr3p and the i-AAA complex

2. Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

  • Separate native protein complexes while preserving their interactions

  • Detect shifts in complex migration patterns in wild-type versus deletion mutants

Previous BN-PAGE analysis showed:

  • MGR1-myc comigrates with Yme1p in a complex larger than 667 kDa

  • In mitochondria lacking MGR3, MGR1 fails to comigrate with Yme1p despite detectable interaction in Co-IP experiments

3. Substrate Interaction Assays:

  • Use model substrates such as Yta10(161)-DHFR^MUT^

  • Assess binding capacity of individual components versus the intact complex

Research has demonstrated that:

  • Both MGR1 and MGR3 can bind substrates independently of Yme1p

  • Efficient binding of substrates to Yme1p requires both MGR1 and MGR3

4. Yeast Two-Hybrid System:

  • Map binary interactions between MGR1 and other complex components

  • Identify specific domains involved in protein-protein interactions

5. Crosslinking Coupled with Mass Spectrometry:

  • Use chemical crosslinkers to capture transient interactions

  • Identify interaction interfaces through mass spectrometry analysis of crosslinked peptides

These methodologies provide complementary information about the composition, stoichiometry, and dynamics of the i-AAA protease complex and MGR1's role within it.

What phenotypic assays best reveal the functional significance of MGR1 in Candida glabrata?

The following phenotypic assays have proven valuable for assessing MGR1 function in C. glabrata:

1. Virulence Assays:

  • Galleria mellonella Infection Model:

    • Inject larvae with ~5 × 10^7 CFU/larvae of wild-type or Δmgr1 cells

    • Monitor survival rates over 72 hours

    • Quantify fungal burden in hemolymph at various time points

This approach has revealed that:

  • Δmgr1 deletion reduces killing ability by ~30% compared to wild-type strains

  • Wild-type cells reach 4.5-fold higher concentrations than Δmgr1 mutants in hemolymph after 48 hours

2. Stress Resistance Assays:

  • Oxidative Stress: Growth on media containing H₂O₂ or menadione

  • Acetic Acid Stress: Growth in media with varying acetic acid concentrations

  • Temperature Sensitivity: Growth at elevated (37-42°C) or reduced (16-20°C) temperatures

3. Mitochondrial Function Assays:

  • Respiration Measurements:

    • Oxygen consumption rates using Clark-type electrodes

    • Growth on non-fermentable carbon sources (e.g., glycerol)

  • Mitochondrial Membrane Potential:

    • Fluorescent dyes such as MitoBright LT Red or TMRM

    • Flow cytometry or fluorescence microscopy quantification

4. Protein Degradation Assays:

  • Using reporter constructs like Nde1p-HA:

    • Add cycloheximide to stop protein synthesis

    • Monitor protein degradation kinetics by Western blot

    • Calculate half-life (t₁/₂) of the reporter

This approach has shown that:

  • Nde1p-HA has a half-life of ~25 min in wild-type cells

  • Deletion of MGR1 extends half-life to ~36 min

  • Complete Yme1p deletion fully stabilizes the substrate

5. ROS Accumulation Assays:

  • Measure reactive oxygen species using fluorescent probes like DCFDA

  • Compare ROS levels between wild-type and Δmgr1 strains under normal and stress conditions

6. Drug Susceptibility Testing:

  • Broth microdilution assays with azoles (fluconazole, voriconazole)

  • Echinocandin susceptibility testing (caspofungin, micafungin)

  • Time-kill kinetics to assess tolerance phenotypes

These assays collectively provide a comprehensive functional characterization of MGR1's role in mitochondrial quality control, stress resistance, and virulence.

How can researchers resolve seemingly contradictory findings about MGR1's role in antifungal resistance?

When analyzing conflicting data regarding MGR1's role in antifungal resistance, consider the following analytical approaches:

1. Context-Dependent Effects Analysis:

Examine how experimental conditions might influence outcomes:

VariablePotential Impact on ResultsAnalytical Approach
Growth phaseDifferent metabolic states affect resistanceStandardize OD/cell counts across experiments
Media compositionCarbon source influences respiratory metabolismCompare results in defined vs. complex media
Drug concentrationSub-MIC vs. fungicidal concentrationsUse concentration-response curves rather than single concentrations
Incubation timeTolerance vs. resistance phenotypesDistinguish between time-kill kinetics and endpoint MICs
Genetic backgroundStrain-specific effectsInclude multiple reference strains in analyses

2. Pathway Interaction Analysis:

MGR1 affects multiple cellular pathways that can have opposing effects on drug resistance:

3. Resolving Specific Contradictions:

For contradictory findings between MGR1 and other mitochondrial components:

  • GEM1 vs. MGR1 effects: While GEM1 deletion increases azole resistance , its effects on mitochondrial morphology differ from those of MGR1 disruption. Analyze whether different aspects of mitochondrial function are affected.

  • Petite phenotype connection: Determine whether MGR1 deletion impacts mitochondrial DNA stability, as the petite phenotype strongly influences azole resistance .

  • Drug class-specific effects: Systematically compare resistance profiles across different antifungal classes (azoles, echinocandins, polyenes) to identify drug-specific mechanisms.

4. Integrated Multi-Omics Approach:

Combine transcriptomics, proteomics, and metabolomics to develop a comprehensive model:

  • Transcriptomic analysis of drug efflux pump expression (CDR1, CDR2)

  • Proteomic analysis of i-AAA complex assembly and substrate profiles

  • Metabolomic analysis of altered mitochondrial metabolism

This integrated approach can help reconcile seemingly contradictory findings by revealing how MGR1 impacts multiple interconnected pathways simultaneously.

What bioinformatic approaches are most useful for analyzing sequence conservation and predicting functional domains in MGR1?

The following bioinformatic approaches are recommended for MGR1 sequence analysis:

1. Multiple Sequence Alignment (MSA) Tools:

  • MUSCLE or CLUSTAL for alignment of MGR1 homologs across fungal species

  • T-Coffee for incorporating structural information where available

  • MEGA for phylogenetic analysis of evolutionary relationships

2. Functional Domain Prediction:

  • InterProScan to identify conserved domains and motifs

  • TMHMM or TOPCONS for transmembrane domain prediction (important for mitochondrial inner membrane proteins)

  • SignalP and TargetP for mitochondrial targeting sequence prediction

  • COILS for coiled-coil domain prediction (potentially involved in protein-protein interactions)

3. Structural Analysis:

  • AlphaFold2 or RoseTTAFold for protein structure prediction

  • PyMOL or UCSF Chimera for structural visualization and analysis

  • CASTp for potential binding pocket identification

4. Protein-Protein Interaction Predictions:

  • STRING database for known and predicted protein interactions

  • PSIPRED for secondary structure prediction to identify potential interaction interfaces

  • MirrorTree analysis to detect co-evolution with known interaction partners

5. Evolutionary Conservation Analysis:

  • ConSurf for identifying functionally important residues based on evolutionary conservation

  • PAML for detecting sites under positive selection

  • FunFHMMer for functional classification based on evolutionary patterns

6. Comparative Genomics Approaches:

  • Synteny analysis to examine conservation of genomic context

  • Analysis of adaptive evolution in pathogenic vs. non-pathogenic species

Example Application:
When analyzing the MGR1 sequence (Q6FX96) from C. glabrata, researchers should:

  • Perform MSA with homologs from S. cerevisiae, C. albicans, and other relevant species

  • Map the degree of conservation onto predicted structural models

  • Identify regions conserved specifically in pathogenic fungi but not in non-pathogenic relatives

  • Focus functional studies on highly conserved regions likely to be essential for i-AAA complex assembly or substrate recognition

This approach can reveal functional domains specific to C. glabrata MGR1 that might contribute to its role in virulence and stress resistance.

How can large-scale genomic and transcriptomic data be leveraged to understand MGR1's role in clinical isolates of Candida glabrata?

Large-scale -omics data can provide valuable insights into MGR1's clinical relevance:

1. Clinical Isolate Genomic Analysis:

Study MGR1 sequence variations across clinical isolates:

  • Identify single nucleotide polymorphisms (SNPs) in MGR1 coding sequences

  • Correlate variants with antifungal resistance phenotypes

  • Examine copy number variations that might affect MGR1 expression levels

Research has revealed that C. glabrata clinical isolates show substantial genetic diversity, with isolates belonging to 29 separate sequence types (STs), each separated by large numbers of variants . This diversity could impact MGR1 function across different clinical strains.

2. Transcriptomic Analysis Approaches:

  • Differential Expression Analysis:

    • Compare MGR1 expression levels between azole-resistant and susceptible isolates

    • Identify co-expressed genes to map functional networks

    • Analyze expression changes following antifungal exposure or host cell interaction

  • Single-Cell RNA Sequencing:

    • Examine heterogeneity in MGR1 expression across populations

    • Identify rare drug-tolerant subpopulations with altered MGR1 expression

Recent studies using single-cell RNA sequencing revealed that echinocandin-tolerant C. glabrata cells display a transcriptional signature distinct from the typical stress response, characterized by altered chromosome structure, DNA topology, and downregulation of oxidative stress responses .

3. Integration with Clinical Metadata:

Correlate MGR1 sequence/expression data with:

  • Treatment outcomes

  • Antifungal resistance patterns

  • Site of infection (bloodstream vs. mucosal)

  • Host immune status

  • Geographic origin

4. Mitochondrial Genome Analysis:

Given MGR1's mitochondrial function, analyze mitochondrial genome variations:

  • C. glabrata mitochondrial genomes show hyperdiversity compared to nuclear genomes

  • Many isolates display gene deletions that could impact mitochondrial function

  • Up to 59% of mitochondrial genes can be absent in some isolates

5. Analysis Workflow for Clinical Data:

  • Collect whole-genome sequences from diverse clinical isolates

  • Extract and analyze MGR1 coding sequences and regulatory regions

  • Compare mitochondrial genome integrity across isolates

  • Perform transcriptomic analysis under standardized conditions

  • Correlate genetic/expression patterns with phenotypic data

  • Build predictive models for virulence and drug resistance

This integrated approach can reveal how MGR1 variations contribute to C. glabrata pathogenicity and treatment outcomes in clinical settings, potentially identifying MGR1 as a biomarker for predicting antifungal resistance or virulence potential.

What are the most promising strategies for targeting MGR1 or the i-AAA protease complex for antifungal development?

Based on current understanding, several strategies show promise for targeting MGR1 or the i-AAA complex:

1. Direct Inhibition Approaches:

  • Small molecule inhibitors: Design compounds that disrupt the interaction between MGR1 and Yme1p or Mgr3p

  • Peptide mimetics: Develop peptides that mimic substrate binding regions to competitively inhibit the adaptor function

  • Allosteric modulators: Target regulatory sites that control MGR1's ability to recognize substrates

2. Conditional Expression Modulation:

  • Antisense oligonucleotides: Design molecules that bind MGR1 mRNA to prevent translation

  • RNA interference: Develop siRNA/shRNA strategies, although delivery remains challenging in fungi

  • Riboswitches: Engineer conditional expression systems that respond to infection-specific cues

3. Indirect Targeting Strategies:

  • Stress sensitization: Develop compounds that create cellular stresses that overwhelm the i-AAA complex capacity

  • Synthetic lethality: Identify pathways that become essential when MGR1 function is compromised

  • Metabolic targeting: Exploit alterations in mitochondrial metabolism resulting from i-AAA complex dysfunction

4. Host-Directed Therapies:

  • Immune modulation: Enhance host recognition of C. glabrata with compromised mitochondrial function

  • Phagocyte activation: Develop strategies to overcome the enhanced phagocyte survival of mitochondrially compromised fungi

5. Combination Therapy Approaches:

  • Antifungal potentiation: Identify compounds that inhibit MGR1 and synergize with existing antifungals

  • Sequential therapy: Target mitochondrial function to prevent development of resistance to primary antifungals

Research Priorities:

  • Develop high-throughput screening assays for identifying MGR1 inhibitors

  • Elucidate the structural basis of MGR1-substrate and MGR1-Yme1p interactions

  • Investigate how MGR1 inhibition affects virulence in diverse infection models

  • Determine whether MGR1 inhibition can resensitize resistant clinical isolates to existing antifungals

These strategies could lead to novel therapeutic approaches targeting a system essential for C. glabrata stress adaptation and virulence.

What unanswered questions remain about the molecular mechanisms of MGR1 function in mitochondrial protein quality control?

Despite significant progress, several key questions about MGR1 remain unanswered:

1. Substrate Specificity Mechanisms:

  • How does MGR1 distinguish between damaged and functional proteins?

  • What sequence or structural features do MGR1-recognized substrates share?

  • Does MGR1 undergo conformational changes upon substrate binding?

2. Regulatory Mechanisms:

  • Is MGR1 activity regulated by post-translational modifications?

  • How is MGR1 expression controlled during stress responses?

  • Does MGR1 undergo regulated turnover to modulate i-AAA protease activity?

3. Structural Questions:

  • What is the three-dimensional structure of MGR1 and how does it interact with the i-AAA complex?

  • How does the MGR1-Mgr3p subcomplex form and interact with Yme1p?

  • Are there additional, unidentified components of the i-AAA complex?

4. Functional Redundancy:

  • Are there compensatory mechanisms that activate when MGR1 function is lost?

  • Do other mitochondrial quality control systems (like m-AAA protease) compensate for i-AAA deficiency?

  • How do parallel quality control systems coordinate with the i-AAA complex?

5. Pathogenesis Connection:

  • What specific substrates of MGR1 are critical for virulence?

  • How does MGR1-mediated protein quality control influence adaptation to host environments?

  • Is MGR1 function altered during infection compared to laboratory growth conditions?

6. Evolutionary Questions:

  • Why has MGR1 function been conserved across diverse fungal species?

  • Are there pathogen-specific adaptations in MGR1 function?

  • How has the interaction between MGR1 and its partners evolved?

7. Technological Limitations:

  • Current challenges in visualizing the i-AAA complex in situ

  • Difficulties in reconstituting the complete i-AAA complex in vitro

  • Limitations in identifying the complete substrate repertoire of MGR1

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.