Recombinant Candida glabrata Mitochondrial inner membrane magnesium transporter LPE10 (LPE10)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Candida glabrata Mitochondrial Inner Membrane Magnesium Transporter LPE10 (LPE10)

Recombinant Candida glabrata Mitochondrial inner membrane magnesium transporter LPE10 (LPE10) is a protein involved in transporting magnesium ions across the inner mitochondrial membrane in the yeast species Candida glabrata . Magnesium transporters like LPE10 are crucial because magnesium is essential for various cellular processes, including energy metabolism, nucleic acid and protein synthesis, and cell cycle control . LPE10 is a member of the CorA superfamily of magnesium transporters, which are found in various organisms .

Gene Information and Nomenclature

The LPE10 protein is encoded by the gene CAGL0M07249g in Candida glabrata . LPE10 is the gene name, and CAGL0M07249g is another identifier for this gene . The protein is also known as Mitochondrial inner membrane magnesium transporter LPE10 and uncharacterized protein CAGL0M07249g .

Homology and Function

LPE10 shares homology with other magnesium transporters, such as MRS2, and both are located in the mitochondrial inner membrane . While MRS2 has been shown to directly mediate magnesium transport, direct magnesium transport activity has not been demonstrated for LPE10 . LPE10 and MRS2 may form heterodimers and function together in magnesium uptake in mitochondria .

Subcellular Localization

LPE10 is localized to the mitochondria . Specifically, it resides in the inner membrane, where it plays a role in maintaining magnesium levels within the organelle .

Expression and Purity

Recombinant LPE10 can be produced in various expression systems, including E. coli, yeast, baculovirus, or mammalian cells . Recombinant LPE10 protein typically has a purity of ≥ 85%, as determined by SDS-PAGE .

Functional Studies and Mutant Analysis

Mutations in LPE10 can alter the magnesium content of yeast mitochondria and affect RNA splicing activity within the organelle . Overexpression of LPE10 does not fully complement the loss of MRS2, suggesting that both proteins may be required for proper mitochondrial magnesium homeostasis .

Role in Magnesium Homeostasis

LPE10 is important for magnesium homeostasis in yeast mitochondria . Together with MRS2, LPE10 contributes to the regulation of magnesium uptake and distribution within the mitochondria .

Magnesium Transporters in General

Magnesium transporters are proteins that transport magnesium across cell membranes and are essential for all forms of life . Besides LPE10, other magnesium transporters include CorA, MgtA, MgtB, MgtE, ALR, MNR, MRS2, CNNM, TRPM6, and TRPM7 . These transporters are found in various cellular locations, including the plasma membrane, vacuoles, and mitochondrial membranes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
LPE10; CAGL0M07249g; Mitochondrial inner membrane magnesium transporter LPE10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-397
Protein Length
Full Length of Mature Protein
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Target Names
LPE10
Target Protein Sequence
TAALLLQKNLIQRNNMLYGHGSGTIRCTVFDAGGNIVSPALDIKREELVAKHGLLPRDLR KIEKSRKNDLVPSFLVRKNGILVSLATIKTLIKPDMVIVFDSFGSLNSTSHKAFLNSLKL RLQNLDMVELKKDPLPYEFRALESIFISALSNLTSEMNVQVTICKGILQDLEYSITRDKL KFLLGQNKKLSNFYKKTVLIRDMLDDLLEQSDVLCSMYLSDLKNGVEHKDDDHSEIEMLL ETYHNHLDEIVQITENIISNVKTTEEIINIILDSNRNQLMLLGIRFSIGMLSLGGPIFIG SLYGMNLENFIEETDYGFIAASAIGMISLGALYFYSIKHLHKLQKMSLFNYTNYARDVKK
Uniprot No.

Target Background

Function
Recombinant *Candida glabrata* Mitochondrial inner membrane magnesium transporter LPE10 (LPE10) is a mitochondrial inner membrane magnesium transporter crucial for maintaining mitochondrial magnesium homeostasis. It modulates the conductance of the MRS2 channel and participates in the splicing of mitochondrial mRNA group II introns by influencing mitochondrial magnesium concentrations, which are essential for this splicing process.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does LPE10 differ from its homologue in Saccharomyces cerevisiae?

The LPE10 protein in C. glabrata shares functional similarities with its S. cerevisiae homologue, but with distinct characteristics. In S. cerevisiae, Lpe10p is crucial for maintaining the mitochondrial membrane potential (ΔΨ), a function not observed with Mrs2p. Loss of Lpe10p in S. cerevisiae results in significant reduction of mitochondrial membrane potential, whereas mrs2Δ cells maintain normal membrane potential . To investigate these differences, researchers should employ membrane potential-sensitive dyes like TMRM or JC-1 and perform complementation studies with heterologous expression of C. glabrata LPE10 in S. cerevisiae lpe10Δ mutants to assess functional conservation.

What experimental evidence supports LPE10's role in magnesium transport?

Experimental evidence for LPE10's role in magnesium transport comes from multiple approaches:

  • Deletion studies showing that lpe10Δ cells exhibit loss of rapid Mg²⁺ influx into mitochondria

  • Patch-clamp experiments demonstrating altered conductance in reconstituted membrane systems

  • Complementation assays where only coexpression of MRS2 and LPE10 fully restores function in double deletion mutants

Researchers investigating this aspect should measure mitochondrial magnesium uptake using mag-fura-2 fluorescence assays and perform electrophysiological studies of isolated mitochondrial membranes .

What are the key structural domains of LPE10 important for its function?

The key structural domains of LPE10 include:

DomainPositionFunction
N-terminal region38-100Targeting and membrane insertion
Transmembrane domainsMultiple regionsChannel formation and ion selectivity
GMN motifConserved motifMg²⁺ selectivity filter, similar to bacterial CorA transporters
C-terminal region300-397Regulatory function and interaction with other proteins

Research indicates that the mature protein spans amino acids 38-397, with the full amino acid sequence containing critical residues for magnesium transport and protein-protein interactions . Mutational analysis of LPE10 and domain swaps between Mrs2p and Lpe10p suggest that the domains responsible for maintaining membrane potential and magnesium influx are functionally separated . For structural studies, researchers should employ techniques such as site-directed mutagenesis followed by functional complementation assays.

How does the interaction between LPE10 and Mrs2p affect magnesium transport?

The interaction between LPE10 and Mrs2p is crucial for optimal magnesium transport, as evidenced by several key findings:

  • Cross-linking and Blue native PAGE experiments indicate direct interaction between Lpe10p and the Mrs2p-containing channel complex

  • Patch clamp studies demonstrate that Lpe10p alone cannot mediate high-capacity Mg²⁺ influx

  • Coexpression of Lpe10p and Mrs2p yields a unique, reduced conductance compared to Mrs2p channels alone

This suggests that LPE10 functions as a regulatory subunit that modulates the activity of the Mrs2p-based magnesium channel rather than forming an independent channel . To study this interaction, co-immunoprecipitation assays, FRET analyses of tagged proteins, and electrophysiological studies of reconstituted channels are recommended methodological approaches.

What expression systems are optimal for producing recombinant LPE10 for structural studies?

For structural studies of LPE10, several expression systems have been employed with varying degrees of success:

Expression SystemAdvantagesLimitationsYield
E. coliHigh yield, simple handling, cost-effectiveMay lack proper folding for membrane proteinsModerate to high
Yeast (S. cerevisiae)Native-like environment, proper foldingLower yield than bacterial systemsModerate
Insect cellsBetter for eukaryotic membrane proteinsMore complex, expensiveHigh

E. coli has been successfully used to express recombinant LPE10 with N-terminal His tags . When producing recombinant LPE10, researchers should optimize expression conditions by testing different detergents for solubilization and consider using fusion partners to improve solubility and folding. Purification strategies typically involve immobilized metal affinity chromatography followed by size exclusion chromatography.

What methods are most effective for analyzing LPE10's magnesium transport function?

The following methodological approaches are recommended for analyzing LPE10's magnesium transport function:

  • Isolated mitochondria assays: Measure magnesium uptake in isolated mitochondria using fluorescent indicators like mag-fura-2

  • Patch-clamp electrophysiology: Determine channel conductance properties using mitochondrial inner membrane vesicles

  • Reconstituted liposome assays: Assess magnesium transport in reconstituted proteoliposomes containing purified LPE10 alone or with Mrs2p

  • Membrane potential measurements: Monitor ΔΨ using voltage-sensitive dyes like TMRM or JC-1 during magnesium transport

Particular attention should be paid to the experimental conditions, as the restoration of Mg²⁺ influx in lpe10Δ cells can be achieved by artificially increasing the membrane potential using the K⁺/H⁺-exchanger nigericin .

Is there evidence linking mitochondrial magnesium transport to antifungal drug resistance?

While direct evidence linking LPE10-mediated magnesium transport to drug resistance is limited, several indirect connections exist:

  • Mitochondrial function impacts cellular stress responses that may influence drug tolerance

  • Changes in membrane potential can affect drug accumulation in fungal cells

  • Metabolic adaptations dependent on proper mitochondrial function may contribute to survival under antifungal pressure

Research indicates that C. glabrata has intrinsically high azole resistance , and fluctuations in fluconazole minimum inhibitory concentration have been observed in clinical isolates . To investigate potential connections between LPE10 and drug resistance, researchers should generate LPE10 knockout strains and assess their susceptibility to various antifungal agents, particularly focusing on drugs targeting mitochondrial functions.

How do mutations in LPE10 affect mitochondrial membrane potential and what are the molecular mechanisms involved?

Investigations into LPE10 mutations have revealed fascinating insights into the relationship between protein structure and mitochondrial function. The loss of LPE10 leads to significant reduction in mitochondrial membrane potential (ΔΨ), a phenotype not observed in mrs2Δ cells . This suggests that LPE10 has a distinct role in maintaining ΔΨ independent of its function in magnesium transport.

The molecular mechanisms may involve:

  • Direct interaction with components of the electron transport chain

  • Regulation of proton leak across the inner mitochondrial membrane

  • Modulation of other ion channels that influence membrane potential

Research methodologies should include site-directed mutagenesis of conserved domains followed by membrane potential measurements using potentiometric dyes. Complementation studies with chimeric proteins containing domains from LPE10 and Mrs2p can help identify the specific regions responsible for ΔΨ maintenance.

What is the evolutionary relationship between LPE10 in different fungal species and how does this inform our understanding of its function?

Evolutionary analysis of LPE10 across fungal species reveals patterns of conservation and divergence that may explain functional specializations:

SpeciesLPE10 HomologyFunctional Specialization
C. glabrataReferenceMitochondrial Mg²⁺ transport
S. cerevisiaeHigh similarityMembrane potential maintenance
C. albicansModerate similarityNot fully characterized
Other fungiVariableSpecies-specific adaptations

Phylogenetic analyses coupled with functional studies can reveal how LPE10 has evolved to support specific niche adaptations across fungal species. Researchers should employ comparative genomics approaches and heterologous expression studies to determine if functional differences correlate with sequence divergence in key domains.

What are the challenges and strategies for developing assay systems to screen for compounds targeting LPE10 function?

Developing screens for compounds targeting LPE10 presents several technical challenges:

  • Membrane protein complexity: LPE10 is an integral membrane protein, making high-throughput assays difficult

  • Functional redundancy: The interplay between LPE10 and Mrs2p may complicate target validation

  • Specificity concerns: Ensuring compounds don't affect human homologues

Viable strategies include:

  • Yeast-based screening systems: Developing growth assays in mrs2Δ/lpe10Δ S. cerevisiae with heterologous expression of C. glabrata LPE10

  • Reconstituted transport assays: Using purified protein in liposomes loaded with magnesium-sensitive fluorophores

  • Structure-based approaches: If crystal structures become available, in silico screening for compounds binding to critical domains

For validation, researchers should assess the effects of identified compounds on mitochondrial function, magnesium homeostasis, and fungal growth under various conditions.

What are the optimal storage and handling conditions for recombinant LPE10 protein?

For optimal stability and activity of recombinant LPE10 protein:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles, which significantly reduce protein activity

  • For working solutions, store aliquots at 4°C for up to one week

Researchers should confirm protein integrity by SDS-PAGE before experimental use, with expected purity greater than 90%. The recommended storage buffer is Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What experimental controls are essential when working with recombinant LPE10 in functional studies?

When conducting functional studies with recombinant LPE10, the following controls are essential:

  • Denatured LPE10: To distinguish specific from non-specific effects

  • Mrs2p alone: To compare with LPE10 alone and LPE10/Mrs2p co-expression

  • Tagged vs. untagged versions: To assess potential interference from affinity tags

  • Empty vector controls: For expression systems

  • Species-specific controls: Testing homologues from other fungi to assess conservation of function

Additionally, when studying mitochondrial magnesium transport, researchers should control for membrane potential effects by using ionophores like nigericin, which has been shown to artificially increase ΔΨ and restore Mg²⁺ influx in lpe10Δ cells but not in mrs2Δ/lpe10Δ double mutants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.